Canmetcon
Identification
Name:L-serine dehydratase 1
Synonyms:
  • SDH 1
  • L-serine deaminase 1
  • L-SD1
Gene Name:sdaA
Enzyme Class:
Biological Properties
General Function:Involved in L-serine ammonia-lyase activity
Specific Function:Deaminates also threonine, particularly when it is present in high concentration
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
SMPDB Reactions:
L-Serine+ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB036092-Aminoacrylic acidMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00187L-SerineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
4 iron, 4 sulfur cluster binding
ammonia-lyase activity
binding
carbon-nitrogen lyase activity
catalytic activity
iron-sulfur cluster binding
L-serine ammonia-lyase activity
lyase activity
metal cluster binding
Process
alcohol metabolic process
gluconeogenesis
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
small molecule metabolic process
Gene Properties
Blattner:b1814
Gene OrientationClockwise
Centisome Percentage:40.84
Left Sequence End1894956
Right Sequence End1896320
Gene Sequence:
>1365 bp
ATGTCTTTCGATTCTTTGGGTTTAAGCCCTGATATCCTGCGCGCCGTTGCCGAGCAGGGT
TACCGTGAACCCACCCCTATTCAGCAGCAGGCGATCCCTGCGGTGCTGGAAGGCCGCGAC
CTGATGGCTAGCGCCCAGACCGGCACCGGCAAAACAGCGGGCTTTACGCTGCCGCTGTTG
CAACACCTGATCACTCGCCAGCCGCACGCCAAAGGGCGTCGTCCGGTACGTGCGCTCATT
CTTACCCCGACCCGTGAACTGGCGGCGCAGATTGGCGAAAACGTCCGTGATTACAGCAAA
TACCTGAACATTCGTTCGCTGGTGGTGTTTGGTGGTGTGAGTATTAACCCGCAGATGATG
AAACTGCGTGGCGGCGTTGATGTGCTGGTGGCAACCCCGGGACGTTTGCTGGACCTGGAA
CATCAGAATGCAGTGAAGCTGGATCAGGTTGAAATCCTCGTCCTCGATGAAGCTGACCGC
ATGCTCGACATGGGCTTTATCCACGATATCCGTCGCGTGTTAACAAAACTACCTGCGAAG
CGCCAGAACCTGTTATTCTCCGCGACCTTCTCTGACGATATTAAAGCCCTGGCGGAAAAA
CTGTTGCACAACCCGCTGGAAATCGAAGTGGCACGCCGCAATACCGCGTCTGATCAGGTG
ACCCAGCACGTTCACTTTGTCGATAAGAAACGCAAACGCGAATTGCTGTCGCACATGATT
GGGAAAGGGAACTGGCAGCAGGTGCTGGTGTTTACCCGTACCAAACACGGCGCTAACCAT
CTGGCTGAACAGCTCAATAAAGATGGCATCCGTAGTGCGGCGATCCACGGCAATAAATCG
CAAGGTGCGCGTACTCGTGCGCTGGCTGATTTTAAATCGGGCGATATTCGTGTACTGGTG
GCAACTGACATCGCTGCGCGCGGCCTGGATATTGAAGAGCTGCCGCACGTCGTCAACTAT
GAACTGCCAAACGTACCTGAAGATTATGTCCACCGTATCGGGCGTACCGGTCGTGCGGCT
GCTACCGGTGAAGCGTTGTCGCTGGTGTGTGTTGATGAACACAAACTGCTGCGTGATATC
GAAAAACTGCTGAAAAAAGAGATCCCGCGCATTGCGATTCCGGGCTATGAGCCGGACCCG
TCAATCAAAGCCGAACCGATCCAGAACGGTCGCCAGCAACGTGGCGGCGGCGGTCGTGGG
CAAGGTGGTGGTCGCGGTCAACAGCAACCACGCCGTGGGGAAGGTGGCGCAAAATCTGCA
AGCGCGAAACCTGCAGAAAAACCGTCTCGCCGCCTCGGCGATGCCAAACCGGCAGGCGAA
CAACAACGTCGCCGCCGTCCGCGTAAACCTGCCGCTGCGCAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:454
Protein Molecular Weight:48906
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>L-serine dehydratase 1
MISLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDSVTRVAVDVYGSLSLTGKGH
HTDIAIIMGLAGNEPATVDIDSIPGFIRDVEERERLLLAQGRHEVDFPRDNGMRFHNGNL
PLHENGMQIHAYNGDEVVYSKTYYSIGGGFIVDEEHFGQDAANEVSVPYPFKSATELLAY
CNETGYSLSGLAMQNELALHSKKEIDEYFAHVWQTMQACIDRGMNTEGVLPGPLRVPRRA
SALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYY
DHFIESVSPDIYTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGG
SPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALRRTSAPRVS
LDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD
References
External Links:
ResourceLink
Uniprot ID:P16095
Uniprot Name:SDHL_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062355
Ecogene ID:EG10930
Ecocyc:EG10930
ColiBase:b1814
Kegg Gene:b1814
EchoBASE ID:EB0923
CCDB:SDHL_ECOLI
BacMap:16129768
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Su, H. S., Lang, B. F., Newman, E. B. (1989). "L-serine degradation in Escherichia coli K-12: cloning and sequencing of the sdaA gene." J Bacteriol 171:5095-5102. Pubmed: 2504697
  • Su, H., Moniakis, J., Newman, E. B. (1993). "Use of gene fusions of the structural gene sdaA to purify L-serine deaminase 1 from Escherichia coli K-12." Eur J Biochem 211:521-527. Pubmed: 8436113