Identification
Name:Fumarate hydratase class I, anaerobic
Synonyms:
  • Fumarase
Gene Name:fumB
Enzyme Class:
Biological Properties
General Function:Involved in lyase activity
Specific Function:It functions in the generation of fumarate for use as an anaerobic electron acceptor
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbL-Malic acid+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb
D-tartrateThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00176Fumaric acidMetaboCard
ECMDB00156L-Malic acidMetaboCard
ECMDB00223Oxalacetic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
carbon-oxygen lyase activity
catalytic activity
fumarate hydratase activity
hydro-lyase activity
lyase activity
Process
cellular metabolic process
generation of precursor metabolites and energy
metabolic process
Gene Properties
Blattner:b4122
Gene OrientationCounterclockwise
Centisome Percentage:93.62
Left Sequence End4343703
Right Sequence End4345349
Gene Sequence:
>1647 bp
ATGTCAAACAAACCCTTTATCTACCAGGCACCTTTCCCGATGGGGAAAGACAATACCGAA
TACTATCTACTCACTTCCGATTACGTTAGCGTTGCCGACTTCGACGGCGAAACCATCCTG
AAAGTGGAACCAGAAGCCCTGACCCTGCTGGCGCAGCAAGCCTTTCACGACGCTTCTTTT
ATGCTCCGCCCGGCACACCAGAAACAGGTTGCGGCTATTCTTCACGATCCAGAAGCCAGC
GAAAACGACAAGTACGTGGCGCTGCAATTCTTAAGAAACTCCGAAATCGCCGCCAAAGGC
GTGCTGCCGACCTGCCAGGATACCGGCACCGCGATCATCGTCGGTAAAAAAGGCCAGCGC
GTGTGGACCGGCGGCGGTGATGAAGAAACGCTGTCGAAAGGCGTCTATAACACCTATATC
GAAGATAACCTGCGCTATTCACAGAATGCGGCGCTGGACATGTACAAAGAGGTCAACACC
GGCACTAACCTGCCTGCGCAAATCGACCTGTACGCGGTAGATGGCGATGAGTACAAATTC
CTTTGCGTTGCGAAAGGCGGCGGCTCTGCCAACAAAACGTATCTCTACCAGGAAACCAAA
GCCCTGCTGACTCCCGGCAAACTGAAAAACTTCCTCGTCGAGAAAATGCGTACCCTCGGT
ACTGCAGCCTGCCCGCCGTACCATATCGCGTTTGTGATTGGCGGTACGTCTGCGGAAACC
AACCTGAAAACCGTCAAGTTAGCAAGCGCTCACTATTACGATGAACTGCCGACGGAAGGG
AACGAACATGGTCAGGCGTTCCGCGATGTCCAGCTGGAACAGGAACTGCTGGAAGAGGCC
CAGAAACTCGGTCTTGGCGCGCAGTTTGGCGGTAAATACTTCGCGCACGACATTCGCGTT
ATCCGTCTGCCACGTCACGGCGCATCCTGCCCGGTCGGCATGGGCGTCTCCTGCTCCGCT
GACCGTAACATTAAAGCGAAAATCAACCGCGAAGGTATCTGGATCGAAAAACTGGAACAC
AACCCAGGCCAGTACATTCCACAAGAACTGCGCCAGGCCGGTGAAGGCGAAGCGGTGAAA
GTTGACCTTAACCGCCCGATGAAAGAGATCCTCGCCCAGCTTTCGCAATACCCGGTATCC
ACTCGTTTGTCGCTCACCGGCACCATTATCGTGGGCCGAGATATTGCACACGCCAAGCTG
AAAGAGCTGATTGACGCCGGTAAAGAACTTCCGCAGTACATCAAAGATCACCCGATCTAC
TACGCGGGTCCGGCGAAAACCCCTGCCGGTTATCCATCAGGTTCACTTGGCCCAACCACC
GCAGGCCGTATGGACTCCTACGTGGATCTGCTGCAATCCCACGGCGGCAGCATGATCATG
CTGGCGAAAGGTAACCGCAGTCAGCAGGTTACCGACGCGTGTCATAAACACGGCGGCTTC
TACCTCGGTAGCATCGGCGGTCCGGCGGCGGTACTGGCGCAGCAGAGCATCAAGCATCTG
GAGTGCGTCGCTTATCCGGAGCTGGGTATGGAAGCTATCTGGAAAATCGAAGTAGAAGAT
TTCCCGGCGTTTATCCTGGTCGATGACAAAGGTAACGACTTCTTCCAGCAAATCGTCAAC
AAACAGTGCGCGAACTGCACTAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:548
Protein Molecular Weight:60105
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Fumarate hydratase class I, anaerobic
MSNKPFIYQAPFPMGKDNTEYYLLTSDYVSVADFDGETILKVEPEALTLLAQQAFHDASF
MLRPAHQKQVAAILHDPEASENDKYVALQFLRNSEIAAKGVLPTCQDTGTAIIVGKKGQR
VWTGGGDEETLSKGVYNTYIEDNLRYSQNAALDMYKEVNTGTNLPAQIDLYAVDGDEYKF
LCVAKGGGSANKTYLYQETKALLTPGKLKNFLVEKMRTLGTAACPPYHIAFVIGGTSAET
NLKTVKLASAHYYDELPTEGNEHGQAFRDVQLEQELLEEAQKLGLGAQFGGKYFAHDIRV
IRLPRHGASCPVGMGVSCSADRNIKAKINREGIWIEKLEHNPGQYIPQELRQAGEGEAVK
VDLNRPMKEILAQLSQYPVSTRLSLTGTIIVGRDIAHAKLKELIDAGKELPQYIKDHPIY
YAGPAKTPAGYPSGSLGPTTAGRMDSYVDLLQSHGGSMIMLAKGNRSQQVTDACHKHGGF
YLGSIGGPAAVLAQQSIKHLECVAYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIVN
KQCANCTK
References
External Links:
ResourceLink
Uniprot ID:P14407
Uniprot Name:FUMB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676874
Ecogene ID:EG10357
Ecocyc:EG10357
ColiBase:b4122
Kegg Gene:b4122
EchoBASE ID:EB0352
CCDB:FUMB_ECOLI
BacMap:16131948
General Reference:
  • Bell, P. J., Andrews, S. C., Sivak, M. N., Guest, J. R. (1989). "Nucleotide sequence of the FNR-regulated fumarase gene (fumB) of Escherichia coli K-12." J Bacteriol 171:3494-3503. Pubmed: 2656658
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Zhang, J., Sprung, R., Pei, J., Tan, X., Kim, S., Zhu, H., Liu, C. F., Grishin, N. V., Zhao, Y. (2009). "Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli." Mol Cell Proteomics 8:215-225. Pubmed: 18723842