Identification
Name:Propionate kinase
Synonyms:Not Available
Gene Name:tdcD
Enzyme Class:
Biological Properties
General Function:Involved in kinase activity
Specific Function:ATP + propanoate = ADP + propanoyl phosphate
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Adenosine diphosphate+propanoyl phosphate+Thumb+ThumbThumb+Thumb
Adenosine diphosphate + propanoyl phosphate + ADP + Propanoyl phosphateAdenosine triphosphate + Propionic acid
ReactionCard
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB01494AcetylphosphateMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB20184Propanoyl phosphateMetaboCard
ECMDB00237Propionic acidMetaboCard
GO Classification:
Component
cell part
intracellular
Function
catalytic activity
kinase activity
phosphotransferase activity, carboxyl group as acceptor
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular metabolic process
metabolic process
organic acid metabolic process
phosphate metabolic process
phosphorus metabolic process
phosphorylation
Gene Properties
Blattner:b3115
Gene OrientationCounterclockwise
Centisome Percentage:70.27
Left Sequence End3260474
Right Sequence End3261682
Gene Sequence:
>1209 bp
ATGGCCTTTTCTCAAGCGGTTAGCGGATTAAACGCTGCCGCCACCAACCTCGATGTTATT
GGCAACAATATCGCCAACTCCGCCACCTACGGCTTTAAATCAGGCACGGCCTCTTTTGCC
GATATGTTTGCCGGTTCGAAAGTGGGACTGGGGGTAAAAGTTGCCGGTATCACTCAGGAC
TTTACCGATGGCACGACCACCAACACCGGGCGAGGTCTGGACGTTGCTATCAGCCAGAAC
GGTTTTTTCCGTCTGGTAGACAGCAACGGTTCGGTGTTCTACAGCCGTAACGGACAATTT
AAGCTGGATGAAAACCGTAACCTGGTGAATATGCAAGGTTTACAGCTGACGGGTTACCCG
GCAACCGGTACGCCGCCGACTATTCAGCAAGGGGCGAATCCGACCAATATTTCGATCCCG
AATACCCTGATGGCAGCGAAAACTACCACCACGGCATCGATGCAGATCAACCTGAATTCC
AGTGATCCGCTTCCTACTGTTACGCCATTCAGCGCCAGCAATGCGGATAGCTATAACAAA
AAAGGTTCGGTGACTGTTTTCGACAGTCAGGGTAATGCTCATGACATGAGCGTCTACTTT
GTGAAGACCGGGGATAATAACTGGCAGGTCTACACCCAGGATAGCAGTGATCCAAACAGC
ATTGCGAAGACAGCGACAACACTGGAATTTAATGCTAATGGCACATTAGTGGATGGTGCG
ATGGCGAATAATATCGCAACCGGCGCAATTAACGGTGCAGAACCCGCCACGTTTAGTCTG
AGCTTCCTCAACTCCATGCAGCAAAATACCGGCGCTAACAATATTGTGGCAACCACCCAG
AACGGCTACAAACCGGGCGATCTGGTGAGTTATCAAATCAATGATGACGGTACGGTTGTC
GGCAACTATTCCAACGAACAAACCCAACTGCTGGGGCAGATTGTACTGGCGAACTTTGCC
AACAACGAAGGTCTGGCATCCGAAGGCGACAACGTCTGGTCTGCGACGCAATCTTCTGGC
GTGGCGCTGTTGGGGACAGCCGGGACGGGAAACTTTGGCACCCTGACCAACGGTGCGCTG
GAAGCGTCCAACGTCGATCTCAGTAAAGAACTGGTCAATATGATCGTTGCCCAGCGTAAC
TATCAGTCTAACGCCCAGACCATCAAAACCCAGGACCAGATCCTCAACACGCTGGTTAAC
TTACGCTAA
Protein Properties
Pfam Domain Function:
Protein Residues:402
Protein Molecular Weight:43384
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Propionate kinase
MNEFPVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSY
EGALKAIAFELEKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLHNY
ANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHR
YVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDV
DFGAMSWVASQTNQSLGDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERAQLAIKTF
VHRIARHIAGHAASLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGLEIDTEMNNRSNSC
GERIVSSENARVICAVIPTNEEKMIALDAIHLGKVNAPAEFA
References
External Links:
ResourceLink
Uniprot ID:P11868
Uniprot Name:TDCD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674830
Ecogene ID:EG11172
Ecocyc:EG11172
ColiBase:b3115
Kegg Gene:b3115
EchoBASE ID:EB1159
CCDB:TDCD_ECOLI
BacMap:145698313
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Goss, T. J., Schweizer, H. P., Datta, P. (1988). "Molecular characterization of the tdc operon of Escherichia coli K-12." J Bacteriol 170:5352-5359. Pubmed: 3053659
  • Grundy, F. J., Waters, D. A., Allen, S. H., Henkin, T. M. (1993). "Regulation of the Bacillus subtilis acetate kinase gene by CcpA." J Bacteriol 175:7348-7355. Pubmed: 8226682
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hesslinger, C., Fairhurst, S. A., Sawers, G. (1998). "Novel keto acid formate-lyase and propionate kinase enzymes are components of an anaerobic pathway in Escherichia coli that degrades L-threonine to propionate." Mol Microbiol 27:477-492. Pubmed: 9484901
  • Schweizer, H. P., Datta, P. (1989). "The complete nucleotide sequence of the tdc region of Escherichia coli." Nucleic Acids Res 17:3994. Pubmed: 2660107