Identification
Name:Argininosuccinate lyase
Synonyms:
  • ASAL
  • Arginosuccinase
Gene Name:argH
Enzyme Class:
Biological Properties
General Function:Involved in argininosuccinate lyase activity
Specific Function:2-(N(omega)-L-arginino)succinate = fumarate + L-arginine
Cellular Location:Cytoplasm (Probable)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
SMPDB Reactions:
ThumbThumb+Thumb
EcoCyc Reactions:
L-arginino-succinateThumb+Thumb
L-arginino-succinate ↔ L-Arginine + Fumaric acid
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB01006Argininosuccinic acidMetaboCard
ECMDB00176Fumaric acidMetaboCard
ECMDB00517L-ArginineMetaboCard
GO Classification:
Function
amidine-lyase activity
argininosuccinate lyase activity
carbon-nitrogen lyase activity
catalytic activity
lyase activity
Process
arginine biosynthetic process
arginine biosynthetic process via ornithine
arginine metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
metabolic process
Gene Properties
Blattner:b3960
Gene OrientationClockwise
Centisome Percentage:89.55
Left Sequence End4154873
Right Sequence End4156246
Gene Sequence:
>1374 bp
ATGGAAAGTAAGAACAAGCTAAAGCGTGGGCTAAGTACCCGCCACATACGCTTTATGGCA
CTGGGTTCAGCAATTGGCACCGGGCTGTTTTACGGTTCGGCAGACGCCATCAAAATGGCC
GGTCCGAGCGTGTTGTTGGCCTATATTATCGGTGGTATCGCGGCGTATATCATTATGCGT
GCGCTGGGGGAAATGTCGGTACATAACCCGGCCGCCAGCTCTTTCTCGCGTTATGCGCAG
GAAAACCTCGGCCCGCTGGCAGGTTACATTACCGGCTGGACCTACTGCTTTGAAATCCTT
ATTGTCGCCATCGCCGATGTGACCGCTTTTGGTATCTATATGGGTGTCTGGTTCCCGACG
GTGCCGCACTGGATTTGGGTACTGAGCGTGGTGCTGATCATTTGCGCCGTAAACCTGATG
AGCGTGAAGGTATTCGGTGAGCTGGAATTCTGGTTCTCGTTCTTTAAAGTCGCCACCATC
ATCATCATGATTGTCGCCGGTTTCGGCATCATCATCTGGGGGATTGGCAACGGCGGGCAA
CCGACCGGTATTCATAACCTGTGGAGCAACGGCGGCTTCTTCAGTAACGGCTGGCTTGGC
ATGGTAATGTCGTTGCAAATGGTGATGTTTGCTTACGGTGGGATCGAAATTATCGGGATT
ACCGCCGGTGAAGCGAAAGATCCTGAGAAATCGATACCGCGTGCGATTAACTCCGTGCCG
ATGCGTATTCTGGTGTTCTACGTCGGTACGCTGTTCGTCATTATGTCTATCTACCCGTGG
AATCAGGTTGGCACTGCCGGTAGCCCGTTCGTGCTGACGTTCCAGCATATGGGCATTACC
TTTGCCGCCAGCATTCTTAACTTTGTTGTGCTGACTGCTTCGCTGTCGGCAATTAACAGT
GATGTATTTGGCGTAGGCCGTATGCTCCACGGTATGGCAGAGCAGGGCAGCGCGCCGAAA
ATTTTCAGCAAAACGTCGCGTCGCGGTATTCCGTGGGTTACGGTGCTGGTGATGACTACC
GCGCTGCTGTTTGCGGTGTATCTGAACTACATCATGCCGGAAAACGTCTTCCTGGTGATC
GCTTCGCTGGCAACCTTCGCCACGGTGTGGGTGTGGATTATGATCCTGCTGTCGCAAATT
GCCTTCCGTCGCCGTTTGCCGCCAGAAGAAGTTAAGGCGCTGAAATTTAAAGTGCCGGGT
GGGGTAGCAACGACCATCGGCGGGCTGATTTTCCTGCTCTTTATTATCGGGTTGATTGGT
TATCACCCGGATACGCGTATCTCGCTGTATGTCGGTTTCGCGTGGATTGTTGTGCTGTTG
ATTGGCTGGATGTTTAAACGCCGCCACGATCGTCAGCTGGCTGAAAACCAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:457
Protein Molecular Weight:50318
Protein Theoretical pI:5
PDB File:1TJ7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Argininosuccinate lyase
MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEE
ALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLW
CKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
AAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCQEAA
QQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDED
VYPILSLQSCLDKRAAKGGVSPQQVAQAIAFAQARLG
References
External Links:
ResourceLink
Uniprot ID:P11447
Uniprot Name:ARLY_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674542
PDB ID:1TJ7
Ecogene ID:EG11223
Ecocyc:EG11223
ColiBase:b3960
Kegg Gene:b3960
EchoBASE ID:EB1205
CCDB:ARLY_ECOLI
BacMap:16131798
General Reference:
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Charlier, D., Piette, J., Glansdorff, N. (1982). "IS3 can function as a mobile promoter in E. coli." Nucleic Acids Res 10:5935-5948. Pubmed: 6292860
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Parsot, C., Boyen, A., Cohen, G. N., Glansdorff, N. (1988). "Nucleotide sequence of Escherichia coli argB and argC genes: comparison of N-acetylglutamate kinase and N-acetylglutamate-gamma-semialdehyde dehydrogenase with homologous and analogous enzymes." Gene 68:275-283. Pubmed: 2851495