Identification
Name:Threonine dehydratase catabolic
Synonyms:
  • Threonine deaminase
Gene Name:tdcB
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Acts on both serine and threonine, and properly considered as a hydroxy amino acid deaminase
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Glycine, serine and threonine metabolism ec00260
  • Metabolic pathways eco01100
  • Valine, leucine and isoleucine biosynthesis ec00290
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB237402-Aminobut-2-enoateMetaboCard
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00187L-SerineMetaboCard
ECMDB00167L-ThreonineMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b3117
Gene OrientationCounterclockwise
Centisome Percentage:70.33
Left Sequence End3263061
Right Sequence End3264050
Gene Sequence:
>990 bp
ATGGCTTCACAACTGACTGATGCATTTGCGCGTAAGTTTTACTACTTGCGCCTGTCGATT
ACCGATGTGTGTAACTTTCGTTGCACCTACTGCCTGCCGGATGGCTACAAACCGAGCGGC
GTCACCAATAAAGGCTTTCTTACCGTCGATGAAATTCGCCGGGTTACGCGCGCCTTCGCC
AGACTGGGCACCGAAAAAGTGCGCCTGACAGGAGGAGAGCCGTCTTTACGCCGCGACTTT
ACCGATATCATCGCCGCTGTGCGGGAAAACGACGCTATCCGCCAGATTGCGGTCACAACC
AATGGTTACCGTCTGGAACGCGATGTGGCGAGCTGGCGCGATGCGGGACTTACTGGCATT
AACGTCAGTGTCGACAGTCTGGACGCCCGCCAGTTTCACGCTATTACCGGGCAGGATAAA
TTCAACCAGGTCATGGCAGGGATTGATGCTGCATTTGAGGCCGGTTTTGAGAAGGTCAAA
GTCAATACCGTGCTGATGCGTGATGTTAATCATCACCAGCTCGACACCTTTCTGAACTGG
ATCCAGCATCGCCCTATCCAGCTGCGTTTCATCGAACTGATGGAAACGGGCGAGGGCAGC
GAGCTCTTCCGTAAGCATCACATCTCTGGTCAGGTTCTGCGTGACGAGCTACTGCGTCGC
GGCTGGATCCACCAATTACGTCAACGCAGCGACGGTCCCGCGCAAGTCTTTTGCCATCCA
GATTACGCCGGAGAGATTGGCCTTATCATGCCGTATGAAAAAGACTTCTGCGCCACTTGC
AACCGCCTGCGCGTTTCCTCCATTGGTAAACTCCATCTCTGCCTGTTTGGTGAAGGCGGC
GTTAACCTGCGCGATCTGCTGGAAGACGATACCCAGCAACAGGCGCTGGAAGCGCGTATT
TCAGCGGCGCTGCGGGAGAAGAAACAGACCCATTTCCTGCATCAAAACAACACCGGTATT
ACGCAAAACTTATCGTACATTGGCGGCTAA
Protein Properties
Pfam Domain Function:
Protein Residues:329
Protein Molecular Weight:35232
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Threonine dehydratase catabolic
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA
References
External Links:
ResourceLink
Uniprot ID:P0AGF6
Uniprot Name:THD2_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651354
Ecogene ID:EG10990
Ecocyc:EG10990
ColiBase:b3117
Kegg Gene:b3117
EchoBASE ID:EB0983
CCDB:THD2_ECOLI
BacMap:16131010
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Datta, P., Goss, T. J., Omnaas, J. R., Patil, R. V. (1987). "Covalent structure of biodegradative threonine dehydratase of Escherichia coli: homology with other dehydratases." Proc Natl Acad Sci U S A 84:393-397. Pubmed: 3540965
  • Goss, T. J., Schweizer, H. P., Datta, P. (1988). "Molecular characterization of the tdc operon of Escherichia coli K-12." J Bacteriol 170:5352-5359. Pubmed: 3053659
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kim, S. S., Datta, P. (1982). "Chemical characterization of biodegradative threonine dehydratases from two enteric bacteria." Biochim Biophys Acta 706:27-35. Pubmed: 6751404
  • Schweizer, H. P., Datta, P. (1989). "The complete nucleotide sequence of the tdc region of Escherichia coli." Nucleic Acids Res 17:3994. Pubmed: 2660107