Identification
Name:conserved protein
Synonyms:Not Available
Gene Name:yjdM
Enzyme Class:
Biological Properties
General Function:Not Available
Specific Function:Not Available
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Microbial metabolism in diverse environments ec01120
  • Phosphonate and phosphinate metabolism ec00440
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB21448PhosphonoacetateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b4108
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>eco:b4108 yjdM; conserved protein; K06193 phosphonoacetate hydrolase [EC:3.11.1.2] (N)
ATGTCATTACCACACTGCCCAAAATGCAACTCCGAATACACCTACGAAGATAACGGCATG
TACATCTGCCCGGAATGTGCCTACGAATGGAACGACGCAGAACCTGCACAGGAAAGCGAC
GAGCTGATCGTTAAAGATGCTAACGGCAATCTGCTGGCTGACGGCGACAGCGTTACCATC
ATTAAAGATCTGAAGGTGAAAGGTAGCTCTTCGATGCTGAAAATTGGCACCAAAGTGAAA
AACATCCGCCTGGTTGAAGGCGACCATAACATCGATTGCAAAATCGACGGTTTTGGTCCG
ATGAAACTGAAATCTGAGTTTGTGAAAAAGAACTGA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:Not Available
Protein Molecular Weight:Not Available
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>eco:b4108 yjdM; conserved protein; K06193 phosphonoacetate hydrolase [EC:3.11.1.2] (A)
MSLPHCPKCNSEYTYEDNGMYICPECAYEWNDAEPAQESDELIVKDANGNLLADGDSVTI
IKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN
References
External Links:
ResourceLink
Uniprot ID:P0AFJ1
ColiBase:b4108
Kegg Gene:b4108
EchoBASE ID:EB0705
BacMap:16131934
General Reference:Not Available