Identification
Name:UPF0076 protein yjgF
Synonyms:Not Available
Gene Name:yjgF
Enzyme Class:
Biological Properties
General Function:Translation, ribosomal structure and biogenesis
Specific Function:May have a phosphotransferase activity
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB23082IminobutyrateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>387 bp
ATGGGCCTGATGTGGGGATTATTCAGCGTCATTATTGCCTCAGTTGCGCAATTAAGCCTG
GGTTTTGCGGCGAGTCATCTGCCGCCGATGACGCACTTATGGGATTTTATCGCGGCTCTG
TTAGCTTTTGGCCTGGATGCCCGGATACTGTTACTCGGGCTGCTGGGTTATCTGCTTTCC
GTTTTTTGTTGGTATAAAACGCTTCATAAACTTGCGCTAAGCAAAGCCTATGCCTTGCTC
AGTATGAGTTATGTGCTGGTATGGATTGCTTCAATGGTACTTCCCGGCTGGGAAGGGACT
TTTTCGCTGAAAGCACTACTGGGAGTAGCCTGTATTATGAGCGGGTTGATGCTGATTTTC
CTGCCCACGACAAAACAACGTTACTGA
Protein Properties
Pfam Domain Function:
Protein Residues:128
Protein Molecular Weight:13612
Protein Theoretical pI:5
PDB File:1QU9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>UPF0076 protein yjgF
MSKTIATENAPAAIGPYVQGVDLGNMIITSGQIPVNPKTGEVPADVAAQARQSLDNVKAI
VEAAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATFPARSCVEVARLPKDVKIE
IEAIAVRR
References
External Links:
ResourceLink
Uniprot ID:P0AF93
Uniprot Name:YJGF_ECOLI
GenBank Gene ID:U00096
Genebank Protein ID:87082075
PDB ID:1QU9
CCDB:YJGF_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Fountoulakis, M., Takacs, M. F., Berndt, P., Langen, H., Takacs, B. (1999). "Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography." Electrophoresis 20:2181-2195. Pubmed: 10493123
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Volz, K. (1999). "A test case for structure-based functional assignment: the 1.2 A crystal structure of the yjgF gene product from Escherichia coli." Protein Sci 8:2428-2437. Pubmed: 10595546