Identification
Name:Modulator of drug activity B
Synonyms:Not Available
Gene Name:mdaB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in coenzyme binding
Specific Function:Specific function unknown
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Menaquinone 8+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB211542-Demethylmenaquinol 8MetaboCard
ECMDB211552-Demethylmenaquinone 8MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Function
binding
catalytic activity
coenzyme binding
cofactor binding
electron carrier activity
oxidoreductase activity
Gene Properties
Blattner:b3028
Gene OrientationClockwise
Centisome Percentage:68.34
Left Sequence End3170552
Right Sequence End3171133
Gene Sequence:
>582 bp
ATGACTGACTACCTGTTACTGTTTGTCGGAACTGTACTGGTCAATAACTTTGTACTGGTC
AAGTTTCTCGGTCTCTGTCCGTTTATGGGGGTTTCCAAAAAACTGGAAACCGCGATGGGC
ATGGGGCTGGCAACAACGTTTGTGATGACGCTGGCGTCTATTTGCGCCTGGCTTATCGAT
ACGTGGATTTTGATCCCACTTAATCTGATTTACCTGCGCACCCTGGCATTTATTCTGGTG
ATTGCTGTGGTCGTGCAGTTCACCGAGATGGTGGTGCGCAAAACCAGCCCGGTGCTTTAC
CGTCTGCTGGGGATTTTTTTGCCGCTTATCACCACCAACTGTGCAGTGCTCGGCGTGGCG
TTGCTGAATATCAATCTCGGGCACAATTTCTTGCAGTCGGCGCTGTACGGTTTTTCCGCC
GCTGTCGGTTTCTCGCTGGTGATGGTGCTCTTCGCCGCCATCCGCGAACGCCTTGCTGTG
GCTGATGTCCCGGCACCTTTTCGCGGTAATGCCATTGCGTTAATTACCGCAGGTCTTATG
TCTCTGGCCTTTATGGGCTTTAGTGGTTTGGTGAAGTTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:193
Protein Molecular Weight:21891
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Modulator of drug activity B
MSNILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDVRIVRADSDYDVKAEVQNFLWA
DVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDGRTRKDPSKKYGSGGLVQGKKYM
LSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRY
TEEYRKHLVEIFG
References
External Links:
ResourceLink
Uniprot ID:P0AEY5
Uniprot Name:MDAB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675048
Ecogene ID:EG12656
Ecocyc:EG12656
ColiBase:b3028
Kegg Gene:b3028
EchoBASE ID:EB2524
CCDB:MDAB_ECOLI
BacMap:16130924
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chatterjee, P. K., Sternberg, N. L. (1995). "A general genetic approach in Escherichia coli for determining the mechanism(s) of action of tumoricidal agents: application to DMP 840, a tumoricidal agent." Proc Natl Acad Sci U S A 92:8950-8954. Pubmed: 7568050
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553