Identification
Name:Formate dehydrogenase, cytochrome b556(fdo) subunit
Synonyms:
  • Aerobic formate dehydrogenase cytochrome b556 subunit
  • FDH-Z subunit gamma
  • Formate dehydrogenase-O subunit gamma
Gene Name:fdoI
Enzyme Class:Not Available
Biological Properties
General Function:Involved in respiratory electron transport chain
Specific Function:Allows to use formate as major electron donor during aerobic respiration. Subunit gamma is probably the cytochrome b556(FDO) component of the formate dehydrogenase
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:
  • Glyoxylate and dicarboxylate metabolism ec00630
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Thumb+menaquinone-8+Electron+ThumbThumb+Thumb+Thumb
Complex Reactions:
2 Thumb+Menaquinone 8+ThumbThumb+Thumb+Thumb
2 Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB04030Carbon dioxideMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Component
cell part
formate dehydrogenase complex
integral to membrane
intrinsic to membrane
macromolecular complex
membrane
membrane part
protein complex
Function
catalytic activity
electron carrier activity
formate dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Process
cellular metabolic process
cellular respiration
electron transport chain
energy derivation by oxidation of organic compounds
generation of precursor metabolites and energy
metabolic process
respiratory electron transport chain
Gene Properties
Blattner:b3892
Gene OrientationCounterclockwise
Centisome Percentage:87.92
Left Sequence End4079248
Right Sequence End4079883
Gene Sequence:
>636 bp
ATGAATAAAGCAAAACGCCTGGAGATCCTCACTCGCCTGCGTGAGAACAATCCTCATCCC
ACCACCGAGCTTAATTTCAGTTCGCCTTTTGAATTGCTGATTGCCGTACTGCTTTCCGCT
CAGGCGACCGATGTCAGTGTTAATAAGGCGACGGCGAAACTCTACCCGGTGGCGAATACG
CCTGCAGCGATGCTTGAACTGGGCGTTGAAGGGGTGAAAACCTATATCAAAACGATTGGG
CTTTATAACAGCAAAGCAGAAAATATCATCAAAACCTGCCGTATCTTGCTGGAGCAGCAT
AATGGCGAGGTTCCGGAAGATCGTGCTGCGCTTGAAGCCCTGCCCGGCGTAGGTCGTAAA
ACAGCCAACGTCGTATTAAACACTGCATTCGGCTGGCCGACTATTGCTGTCGACACGCAC
ATTTTCCGCGTTTGTAATCGTACTCAATTTGCGCCGGGGAAAAACGTCGAACAGGTAGAA
GAAAAGCTACTGAAAGTGGTTCCAGCAGAGTTTAAAGTCGACTGCCACCATTGGTTGATC
CTGCACGGGCGTTATACCTGCATTGCCCGCAAGCCCCGCTGTGGCTCTTGTATTATTGAA
GATCTTTGTGAATACAAAGAGAAAGTTGACATCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:211
Protein Molecular Weight:24606
Protein Theoretical pI:11
Signaling Regions:
  • None
Transmembrane Regions:
  • 18-32
  • 54-72
  • 113-130
  • 152-170
Protein Sequence:
>Formate dehydrogenase, cytochrome b556(fdo) subunit
MKRRDTIVRYTAPERINHWITAFCFILAAVSGLGFLFPSFNWLMQIMGTPQLARILHPFV
GVVMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVGDTGRYNFGQKCVFWAAII
FLVLLLVSGVIIWRPYFAPAFSIPVIRFALMLHSFAAVALIVVIMVHIYAALWVKGTITA
MVEGWVTSAWAKKHHPRWYREVRKTTEKKAE
References
External Links:
ResourceLink
Uniprot ID:P0AEL0
Uniprot Name:FDOI_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742691
Ecogene ID:EG11856
Ecocyc:EG11856
ColiBase:b3892
Kegg Gene:b3892
EchoBASE ID:EB1802
CCDB:FDOI_ECOLI
BacMap:16131732
General Reference:
  • Abaibou, H., Pommier, J., Benoit, S., Giordano, G., Mandrand-Berthelot, M. A. (1995). "Expression and characterization of the Escherichia coli fdo locus and a possible physiological role for aerobic formate dehydrogenase." J Bacteriol 177:7141-7149. Pubmed: 8522521
  • Benoit, S., Abaibou, H., Mandrand-Berthelot, M. A. (1998). "Topological analysis of the aerobic membrane-bound formate dehydrogenase of Escherichia coli." J Bacteriol 180:6625-6634. Pubmed: 9852007
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Plunkett, G. 3rd, Burland, V., Daniels, D. L., Blattner, F. R. (1993). "Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes." Nucleic Acids Res 21:3391-3398. Pubmed: 8346018