Identification
Name:Formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit
Synonyms:
  • Anaerobic formate dehydrogenase cytochrome b556 subunit
  • Formate dehydrogenase-N subunit gamma
  • FDH-N subunit gamma
Gene Name:fdnI
Enzyme Class:Not Available
Biological Properties
General Function:Involved in respiratory electron transport chain
Specific Function:Formate dehydrogenase allows E.coli to use formate as major electron donor during anaerobic respiration, when nitrate is used as electron acceptor. Subunit gamma is the cytochrome b556(FDN) component of the formate dehydrogenase
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Complex Reactions:
2 Thumb+Menaquinone 8+ThumbThumb+Thumb+Thumb
2 Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB04030Carbon dioxideMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Component
cell part
formate dehydrogenase complex
integral to membrane
intrinsic to membrane
macromolecular complex
membrane
membrane part
protein complex
Function
catalytic activity
electron carrier activity
formate dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Process
cellular metabolic process
cellular respiration
electron transport chain
energy derivation by oxidation of organic compounds
generation of precursor metabolites and energy
metabolic process
respiratory electron transport chain
Gene Properties
Blattner:b1476
Gene OrientationClockwise
Centisome Percentage:33.39
Left Sequence End1549362
Right Sequence End1550015
Gene Sequence:
>654 bp
ATGAGTAAGTCGAAAATGATTGTGCGCACCAAATTTATTGATCGCGCCTGTCACTGGACC
GTGGTGATTTGCTTCTTCCTGGTGGCGCTGTCCGGGATTTCGTTCTTCTTCCCGACGCTG
CAATGGCTGACGCAAACCTTCGGTACGCCGCAGATGGGACGCATTTTGCACCCGTTCTTC
GGCATTGCGATTTTCGTCGCACTGATGTTTATGTTTGTGCGTTTTGTGCATCACAACATC
CCGGATAAGAAAGATATTCCGTGGCTGTTGAACATTGTCGAAGTATTGAAAGGCAATGAG
CATAAAGTGGCGGATGTCGGTAAGTACAACGCCGGGCAAAAGATGATGTTCTGGTCGATC
ATGAGCATGATTTTCGTGCTGCTGGTGACCGGGGTGATTATCTGGCGTCCGTACTTTGCG
CAGTACTTCCCGATGCAGGTTGTTCGCTACAGCCTGCTGATCCACGCGGCTGCGGGTATC
ATCCTGATCCACGCCATCCTGATCCATATGTATATGGCATTTTGGGTGAAAGGATCGATT
AAAGGGATGATCGAAGGGAAGGTAAGTCGTCGCTGGGCGAAGAAACACCATCCGCGCTGG
TATCGTGAAATCGAGAAGGCAGAAGCGAAAAAAGAGAGTGAAGAAGGGATATAA
Protein Properties
Pfam Domain Function:
Protein Residues:217
Protein Molecular Weight:25368
Protein Theoretical pI:11
PDB File:1KQG
Signaling Regions:
  • None
Transmembrane Regions:
  • 12-36
  • 53-74
  • 111-134
  • 151-175
Protein Sequence:
>Formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
References
External Links:
ResourceLink
Uniprot ID:P0AEK7
Uniprot Name:FDNI_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742409
PDB ID:1KQG
Ecogene ID:EG11229
Ecocyc:EG11229
ColiBase:b1476
Kegg Gene:b1476
EchoBASE ID:EB1211
CCDB:FDNI_ECOLI
BacMap:16129435
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Berg, B. L., Li, J., Heider, J., Stewart, V. (1991). "Nitrate-inducible formate dehydrogenase in Escherichia coli K-12. I. Nucleotide sequence of the fdnGHI operon and evidence that opal (UGA) encodes selenocysteine." J Biol Chem 266:22380-22385. Pubmed: 1834669
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jormakka, M., Tornroth, S., Byrne, B., Iwata, S. (2002). "Molecular basis of proton motive force generation: structure of formate dehydrogenase-N." Science 295:1863-1868. Pubmed: 11884747