Identification
Name:Phosphatase nudJ
Synonyms:Not Available
Gene Name:nudJ
Enzyme Class:Not Available
Biological Properties
General Function:Involved in hydrolase activity
Specific Function:Catalyzes the hydrolysis of 4-amino-2-methyl-5- hydroxymethylpyrimidine pyrophosphate (HMP-PP) to 4-amino-2- methyl-5-hydroxymethylpyrimidine phosphate (HMP-P), and hydrolysis of thiamine pyrophosphate (TPP) to thiamine monophosphate (TMP). Can hydrolyze other substrates such as MeO-HMP-PP, CF(3)-HMP-PP and MeO-TPP. Is also a non-specific nucleoside tri- and diphosphatase that releases inorganic orthophosphate
Cellular Location:Cytoplasmic
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB200462-Methyl-4-amino-5-hydroxymethylpyrimidine diphosphateMetaboCard
ECMDB200844-Amino-2-methyl-5-phosphomethylpyrimidineMetaboCard
ECMDB01201Guanosine diphosphateMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB02666Thiamine monophosphateMetaboCard
ECMDB01372Thiamine pyrophosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
Gene Properties
Blattner:b1134
Gene OrientationCounterclockwise
Centisome Percentage:25.71
Left Sequence End1193050
Right Sequence End1193511
Gene Sequence:
>462 bp
GTGAGCAGAGTAACCGCGATTATATCCGCTCTGATTATCTGCATCATCGTCAGCCTGTCA
TGGGCGGTCAATCATTACCGTGATAACGCAATCGCCTACAAAGTCCAGCGCGACAAAAAT
GCCAGAGAACTGAAGCTAGCGAACGCGGCAATTACTGACATGCAGATGCGTCAGCGTGAT
GTTGCTGCGCTCGATGCAAAATACACGAAGGAGTTAGCTGATGCGAAAGCTGAAAATGAT
GCTCTGCGTGATGATGTTGCCGCTGGTCGTCGTCGGTTGCACATCAAAGCAGTCTGTCAG
TCAGTGCGTGAAGCCACCACGGCCTCCGGCGTGGATAATGCAGCCTCCCCCCGACTGGCA
GACACCGCTGAACGGGATTATTTCACCCTCAGAGAGAGGCTGATCACTATGCAAAAACAA
CTGGAAGGAACCCAGAAGTATATTAATGAGCAGTGCAGATAG
Protein Properties
Pfam Domain Function:
Protein Residues:153
Protein Molecular Weight:17433
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Phosphatase nudJ
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISA
QPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRS
PLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
References
External Links:
ResourceLink
Uniprot ID:P0AEI6
Uniprot Name:NUDJ_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674691
Ecogene ID:EG13446
Ecocyc:EG13446
ColiBase:b1134
Kegg Gene:b1134
EchoBASE ID:EB3220
CCDB:NUDJ_ECOLI
BacMap:16129097
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Lawhorn, B. G., Gerdes, S. Y., Begley, T. P. (2004). "A genetic screen for the identification of thiamin metabolic genes." J Biol Chem 279:43555-43559. Pubmed: 15292217
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Xu, W., Dunn, C. A., O'handley, S. F., Smith, D. L., Bessman, M. J. (2006). "Three new Nudix hydrolases from Escherichia coli." J Biol Chem 281:22794-22798. Pubmed: 16766526