Identification
Name:AMP nucleosidase
Synonyms:Not Available
Gene Name:amn
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Involved in regulation of AMP concentrations
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB02033D-Ribose-5-phosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
Process
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside metabolic process
Gene Properties
Blattner:b1982
Gene OrientationClockwise
Centisome Percentage:44.25
Left Sequence End2053085
Right Sequence End2054539
Gene Sequence:
>1455 bp
ATGGAACATCAGAGAAAACTATTCCAGCAACGCGGCTATAGCGAAGATCTATTGCCGAAA
ACGCAAAGCCAGCGGACCTGGAAAACATTTAACTATTTTACCTTATGGATGGGTTCGGTT
CATAACGTTCCCAATTATGTGATGGTCGGCGGCTTTTTTATTCTCGGCTTGTCTACCTTT
AGTATTATGCTGGCAATTATCCTCAGCGCCTTTTTCATTGCCGCGGTAATGGTATTAAAC
GGTGCTGCGGGCAGTAAATACGGTGTGCCTTTTGCCATGATCCTGCGTGCTTCTTACGGT
GTACGTGGTGCACTGTTTCCCGGATTATTAAGGGGCGGAATTGCCGCCATCATGTGGTTT
GGTTTGCAATGTTACGCGGGGTCACTGGCCTGCTTGATTCTGATTGGCAAAATCTGGCCG
GGATTTTTAACTCTCGGTGGTGATTTCACTCTGTTAGGCCTTTCTCTACCGGGCTTAATT
ACTTTCTTAATCTTCTGGCTGGTCAACGTTGGTATAGGTTTTGGCGGTGGCAAAGTTTTA
AATAAATTCACTGCCATTCTTAACCCGTGCATCTATATCGTTTTCGGCGGTATGGCGATT
TGGGCGATTTCACTGGTCGGGATCGGTCCAATCTTTGACTACATTCCGAGCGGTATTCAG
AAAGCAGAAAACGGTGGCTTCCTGTTCCTGGTGGTGATTAACGCGGTAGTTGCGGTCTGG
GCGGCACCGGCGGTGAGCGCATCCGACTTTACGCAAAACGCCCACTCGTTTCGTGAGCAG
GCGCTGGGGCAAACGCTGGGTTTAGTTGTGGCCTATATTCTGTTTGCGGTCGCCGGGGTA
TGTATTATTGCCGGAGCCAGTATTCACTACGGCGCTGATACCTGGAACGTGCTGGATATT
GTTCAGCGTTGGGACAGCCTGTTCGCCTCGTTCTTTGCGGTACTGGTTATTCTGATGACA
ACTATCTCCACTAACGCGACCGGTAATATTATTCCAGCCGGTTATCAGATTGCCGCCATT
GCACCGACAAAACTGACCTATAAAAACGGCGTACTGATTGCCAGTATTATCAGCTTGCTG
ATCTGCCCGTGGAAATTAATGGAAAATCAGGACAGCATTTATCTTTTCCTCGATATTATC
GGCGGAATGCTTGGTCCGGTAATTGGTGTCATGATGGCGCATTATTTTGTGGTGATGCGC
GGACAAATTAATCTTGATGAACTGTATACCGCACCTGGCGATTATAAATATTACGATAAC
GGTTTTAACCTCACTGCGTTTTCAGTAACTCTGGTGGCCGTTATTTTATCTCTTGGCGGT
AAGTTTATTCACTTTATGGAACCGTTATCGCGTGTTTCATGGTTTGTCGGCGTCATCGTC
GCCTTTGCGGCCTACGCCTTATTAAAGAAACGTACAACAGCAGAAAAAACAGGAGAGCAA
AAAACCATAGGTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:484
Protein Molecular Weight:53994
Protein Theoretical pI:6
PDB File:1T8Y
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>AMP nucleosidase
MNNKGSGLTPAQALDKLDALYEQSVVALRNAIGNYITSGELPDENARKQGLFVYPSLTVT
WDGSTTNPPKTRAFGRFTHAGSYTTTITRPTLFRSYLNEQLTLLYQDYGAHISVQPSQHE
IPYPYVIDGSELTLDRSMSAGLTRYFPTTELAQIGDETADGIYHPTEFSPLSHFDARRVD
FSLARLRHYTGTPVEHFQPFVLFTNYTRYVDEFVRWGCSQILDPDSPYIALSCAGGNWIT
AETEAPEEAISDLAWKKHQMPAWHLITADGQGITLVNIGVGPSNAKTICDHLAVLRPDVW
LMIGHCGGLRESQAIGDYVLAHAYLRDDHVLDAVLPPDIPIPSIAEVQRALYDATKLVSG
RPGEEVKQRLRTGTVVTTDDRNWELRYSASALRFNLSRAVAIDMESATIAAQGYRFRVPY
GTLLCVSDKPLHGEIKLPGQANRFYEGAISEHLQIGIRAIDLLRAEGDRLHSRKLRTFNE
PPFR
References
External Links:
ResourceLink
Uniprot ID:P0AE12
Uniprot Name:AMN_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674649
PDB ID:1T8Y
Ecogene ID:EG10039
Ecocyc:EG10039
ColiBase:b1982
Kegg Gene:b1982
EchoBASE ID:EB0037
CCDB:AMN_ECOLI
BacMap:16129926
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Leung, H. B., Kvalnes-Krick, K. L., Meyer, S. L., deRiel, J. K., Schramm, V. L. (1989). "Structure and regulation of the AMP nucleosidase gene (amn) from Escherichia coli." Biochemistry 28:8726-8733. Pubmed: 2690948
  • Whipp, M. J., Camakaris, H., Pittard, A. J. (1998). "Cloning and analysis of the shiA gene, which encodes the shikimate transport system of escherichia coli K-12." Gene 209:185-192. Pubmed: 9524262