Identification
Name:Acetolactate synthase isozyme 2 small subunit
Synonyms:
  • ALS-II
  • Acetohydroxy-acid synthase II small subunit
  • AHAS-II
Gene Name:ilvM
Enzyme Class:
Biological Properties
General Function:Involved in acetolactate synthase activity
Specific Function:2 pyruvate = 2-acetolactate + CO(2)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb2 Thumb
Thumb+ThumbThumb+Thumb
2 ThumbThumb+Thumb
SMPDB Reactions:
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Complex Reactions:
2 ThumbThumb+Thumb
2 ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB06855(S)-2-AcetolactateMetaboCard
ECMDB040012-Aceto-2-hydroxy-butyrateMetaboCard
ECMDB040022-AcetolactateMetaboCard
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB01372Thiamine pyrophosphateMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b3769
Gene OrientationClockwise
Centisome Percentage:85.14
Left Sequence End3950224
Right Sequence End3950487
Gene Sequence:
>264 bp
ATGAGCGAGAAATTAAAGATAGTCTATCGCCCATTACAAGAATTGTCACCGTATGCGCAC
AACGCCAGGACGCACAGTACTGAGCAGGTGGCACAACTGGTAGAAAGTATTAAGCAATTC
GGCTGGACTAATCCGGTGCTGATTGACGAAAAGGGCGAAATTATTGCGGGTCACGGTCGT
GTTATGGCGGCTGAAATGCTCAAAATGGATTCTGTTCCGGTCATTGTTCTGTCTGGCCTG
ACGGATGAGCAGAAGCAGCGATAA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:87
Protein Molecular Weight:9703
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetolactate synthase isozyme 2 small subunit
MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLL
FSQLNKLVDVAHVAICQSTTTSQQIRA
References
External Links:
ResourceLink
Uniprot ID:P0ADG1
Uniprot Name:ILVM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674928
Ecogene ID:EG10501
Ecocyc:EG10501
ColiBase:b3769
Kegg Gene:b3769
EchoBASE ID:EB0496
CCDB:ILVM_ECOLI
BacMap:16131627
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kuramitsu, S., Ogawa, T., Ogawa, H., Kagamiyama, H. (1985). "Branched-chain amino acid aminotransferase of Escherichia coli: nucleotide sequence of the ilvE gene and the deduced amino acid sequence." J Biochem 97:993-999. Pubmed: 3897211
  • Lawther, R. P., Wek, R. C., Lopes, J. M., Pereira, R., Taillon, B. E., Hatfield, G. W. (1987). "The complete nucleotide sequence of the ilvGMEDA operon of Escherichia coli K-12." Nucleic Acids Res 15:2137-2155. Pubmed: 3550695
  • Pagel, J. M., Winkelman, J. W., Adams, C. W., Hatfield, G. W. (1992). "DNA topology-mediated regulation of transcription initiation from the tandem promoters of the ilvGMEDA operon of Escherichia coli." J Mol Biol 224:919-935. Pubmed: 1569580