Identification
Name:Acetolactate synthase isozyme 1 small subunit
Synonyms:
  • Acetohydroxy-acid synthase I small subunit
  • AHAS-I
  • ALS-I
Gene Name:ilvN
Enzyme Class:
Biological Properties
General Function:Involved in amino acid binding
Specific Function:2 pyruvate = 2-acetolactate + CO(2)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+2 ThumbThumb+Thumb
Thumb+Thumb2 Thumb
Thumb+Thumb2 Thumb
2 ThumbThumb+Thumb
SMPDB Reactions:
2 Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Complex Reactions:
2 ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB06855(S)-2-AcetolactateMetaboCard
ECMDB040012-Aceto-2-hydroxy-butyrateMetaboCard
ECMDB040022-AcetolactateMetaboCard
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB01372Thiamine pyrophosphateMetaboCard
GO Classification:
Function
acetolactate synthase activity
amino acid binding
binding
carboxylic acid binding
catalytic activity
transferase activity
transferase activity, transferring aldehyde or ketonic groups
Process
branched chain family amino acid biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid biosynthetic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b3670
Gene OrientationCounterclockwise
Centisome Percentage:82.95
Left Sequence End3848825
Right Sequence End3849115
Gene Sequence:
>291 bp
ATGGCTGATTTGAGAAAAGCAGCGCGTGGTCGGGAATGCCAGGTAAGAATCCCTGGCGTA
TGTAATGGCAACCCTGAAACGTCTGTACTGGCACATATCCGGCTGACTGGATTGTGCGGC
ACCGGTACGAAACCGCCAGACCTGATTGCCACCATTGCATGTTCTGCCTGCCACGACGAA
ATCGACCGCCGCACGCATTTTGTTGACGCTGGATATGCAAAAGAATGCGCGCTGGAAGGT
ATGGCGAGAACACAGGTTATCTGGCTGAAAGAGGGGGTTATTAAGGCGTGA
Protein Properties
Pfam Domain Function:
Protein Residues:96
Protein Molecular Weight:11106
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetolactate synthase isozyme 1 small subunit
MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQ
RLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
References
External Links:
ResourceLink
Uniprot ID:P0ADF8
Uniprot Name:ILVN_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674684
Ecogene ID:EG10502
Ecocyc:EG10502
ColiBase:b3670
Kegg Gene:b3670
EchoBASE ID:EB0497
CCDB:ILVN_ECOLI
BacMap:16131540
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Friden, P., Donegan, J., Mullen, J., Tsui, P., Freundlich, M., Eoyang, L., Weber, R., Silverman, P. M. (1985). "The ilvB locus of Escherichia coli K-12 is an operon encoding both subunits of acetohydroxyacid synthase I." Nucleic Acids Res 13:3979-3993. Pubmed: 2989781
  • Friedrich, M. J., Kadner, R. J. (1987). "Nucleotide sequence of the uhp region of Escherichia coli." J Bacteriol 169:3556-3563. Pubmed: 3301805
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Wek, R. C., Hauser, C. A., Hatfield, G. W. (1985). "The nucleotide sequence of the ilvBN operon of Escherichia coli: sequence homologies of the acetohydroxy acid synthase isozymes." Nucleic Acids Res 13:3995-4010. Pubmed: 2989782