Identification
Name:Hydrogenase-2 large chain
Synonyms:
  • HYD2
  • Membrane-bound hydrogenase 2 large subunit
  • NiFe hydrogenase
Gene Name:hybC
Enzyme Class:
Biological Properties
General Function:Involved in nickel cation binding
Specific Function:This is one of three E.coli hydrogenases synthesized in response to different physiological conditions. HYD2 is involved in hydrogen uptake
Cellular Location:Cell membrane; Peripheral membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:
  • Microbial metabolism in diverse environments ec01120
  • Trinitrotoluene degradation ec00633
KEGG Reactions:
2,4-Diamino-6-nitrotoluene2,4-Diamino-6-hydroxylaminotoluene
2,4-Diamino-6-nitrotoluene ↔ 2,4-Diamino-6-hydroxylaminotoluene
ReactionCard
Thumb+AcceptorReduced acceptor
Hydrogen (gas) + Acceptor ↔ Reduced acceptor
ReactionCard
Complex Reactions:
2 Thumb+Thumb+ThumbThumb+2 Thumb
Thumb+2 Thumb+ThumbThumb+2 Thumb
2 Thumb+Thumb+Menaquinone 8Thumb+2 Thumb
Thumb+AAH(2)
Thumb+AAH(2)
Thumb+AAH(2)
Metabolites:
ECMDB IDNameView
ECMDB211542-Demethylmenaquinol 8MetaboCard
ECMDB211552-Demethylmenaquinone 8MetaboCard
ECMDB01362Hydrogen (gas)MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
ferredoxin hydrogenase activity
ion binding
metal ion binding
nickel ion binding
oxidoreductase activity
oxidoreductase activity, acting on hydrogen as donor
oxidoreductase activity, acting on hydrogen as donor, iron-sulfur protein as acceptor
transition metal ion binding
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b2994
Gene OrientationCounterclockwise
Centisome Percentage:67.66
Left Sequence End3139308
Right Sequence End3141011
Gene Sequence:
>1704 bp
ATGGCTTTTGTATCAGAAAGAGAAATTGTAAGAAAGATATTTAGCAAAAAAATTGACTTT
ACGATCTTGGCATTTTTCTATATTTCCTCTATTTTTTTTCTTCTTTGTAGTGGCGTTCTC
TTTCAATATTTTACCGCTGCCTTCACAAAAGGTAATTGTTATGAATGCTCAATGAAACTT
GATTACATAAAACAATTTTATTTTTCACTGGAAACCGCATGGTACCTCATATCTGCTGTT
GCAGTATTTATTGCATCTGTTTTTATACAGCATAGAATTAAAGCTTATTTAACATTATTA
GCTATTACATGGATTGTACTAACAATAACAGATGTGGCGTTAATACACGCCTTAGACAAT
ATAGCCATGAATAATATTTTGTTAAATATACTATATAATCTTTTTGGGGCGATTTTATTG
TCACTGTTTATGTGTTTATCAAATTCCCTCCTTTTCCACCTTAATAAGATAAAACATATT
CCAATGATTTTATCGGCAATGATTCCATTAGTTTCCGCAATAATAATAGCCATACTCATA
ACCGCTGTTATATATTTATTGTTTGCCCGGCAGGCGGTAGAGATTGAGATGGATATATCT
GAAGGTTCAGACATCGCATATGTAGGTGTAAAAGATAATGAGGAATCATTTGGGTTTTTA
AATGATAAAAAAACAGACACACCAACGTATCTGGATGTAATCAAAAATGGTAGTTTGATA
TATAATGATACACAGGGTTTAAGTGGTGCTGATATTTATATTGTCTCCGGTTGTTATGCC
CTTCCAGATTTACTTCGCAATGTACCGCTTGATGCTAAAAAATCTTTTCTGAATGTAAAA
AAGCTAGAAATCACACAGAAACTTCCAATGATGGGGTTCATACAAGGTGAATCCGCTGAT
GTGATGCCTAAAGCAGCATCCAGGTTAAGTTTGAGCAAGCAAGATGATAAATTTATGCTA
GCCTCAAGTGTTACTGACTCTCAAATAAAATTTAAATCAAACAATGCACAATTGATGGTT
GCTTTCGCATTTATGCCAATAACAACGAATGGTATTTTACATGATTATACATACGATATA
ATAATAAATGATAAAAAATATAAAATTGAAAATCATGTTGCACCTCTATCTAGGCTTGAT
AAAAATAAGAAGATGAAGTGTGAATACCAGCAAATATCGGATTTAACAAATACGTATAAC
ATTAATGCAAATTACTTAACGGGTTTTTTACTTGTCCTAAAACCAGATGATATTATTAAT
TACAACAATAGCCCTTCCGTACTACTCAAGACTGATTTTGCGTTCTATAAAAAAACATAC
CAGAAGCTTGATAAAATATATGATGACATAAGCAATGGAAAATTATCTTCACTGAGAGCA
ACAGGTATCTCCCAGTTTAGTATCAACGGGAAACATTTGTCGTTAAGGCCAGAATCGGAG
ATTATTATTTCTGAAGGGAGTTTGTATGGACTAGTTAATAAAAGCAAAAAAATCAAAATA
TATGGCACAGCAGATCTTGTTTTTGTTGATAACAAGATAATGAACCTTCGTAAAATAACT
TATTTGCAATCTAAGCTAGAAATTTTTGGTTCTTCTATTATGGATATATTAAAGTATATA
TTTGGTTTAGGTCTGCTAGCAATTTCTATAAAATTCATTCATTCTTACTTTAAGAATGAT
GTGAATGAAAATTTATTCTTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:567
Protein Molecular Weight:62491
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Hydrogenase-2 large chain
MSQRITIDPVTRIEGHLRIDCEIENGVVSKAWASGTMWRGMEEIVKNRDPRDAWMIVQRI
CGVCTTTHALSSVRAAESALNIDVPVNAQYIRNIILAAHTTHDHIVHFYQLSALDWVDIT
SALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVASGQLGIFANGYWGHPAMKLP
PEVNLIAVAHYLQALECQRDANRVVALLGGKTPHIQNLAVGGVANPINLDGLGVLNLERL
MYIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVNYLSVPEFPTDSKNGSFLFP
GGYIENADLSSYRPITSHSDEYLIKGIQESAKHSWYKDEAPQAPWEGTTIPAYDGWSDDG
KYSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLNEIVAIYQKLTGNTLEVAQLHS
TLGRIIGRTVHCCELQDILQNQYSALITNIGKGDHTTFVKPNIPATGEFKGVGFLEAPRG
MLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQSLVGTPVADPNKPLEVVRTI
HSFDPCMACAVHVVDADGNEVVSVKVL
References
External Links:
ResourceLink
Uniprot ID:P0ACE0
Uniprot Name:MBHM_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1800032
Ecogene ID:EG11801
Ecocyc:EG11801
ColiBase:b2994
Kegg Gene:b2994
EchoBASE ID:EB1749
CCDB:MBHM_ECOLI
BacMap:16130894
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Menon, N. K., Chatelus, C. Y., Dervartanian, M., Wendt, J. C., Shanmugam, K. T., Peck, H. D. Jr, Przybyla, A. E. (1994). "Cloning, sequencing, and mutational analysis of the hyb operon encoding Escherichia coli hydrogenase 2." J Bacteriol 176:4416-4423. Pubmed: 8021226
  • Sargent, F., Ballantine, S. P., Rugman, P. A., Palmer, T., Boxer, D. H. (1998). "Reassignment of the gene encoding the Escherichia coli hydrogenase 2 small subunit--identification of a soluble precursor of the small subunit in a hypB mutant." Eur J Biochem 255:746-754. Pubmed: 9738917