Identification
Name:NifU-like protein
Synonyms:Not Available
Gene Name:nifU
Enzyme Class:Not Available
Biological Properties
General Function:Involved in iron ion binding
Specific Function:May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins (Potential)
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
4 Thumb+IscU with bound [2Fe-2S] cluster[2Fe-2S] iron-sulfur cluster+IscU scaffold protein
4 Hydrogen ion + IscU with bound [2Fe-2S] cluster → [2Fe-2S] iron-sulfur cluster + IscU scaffold protein
ReactionCard
4 Thumb+IscU with bound [4Fe-4S] cluster[4Fe-4S] iron-sulfur cluster+IscU scaffold protein
4 Hydrogen ion + IscU with bound [4Fe-4S] cluster → [4Fe-4S] iron-sulfur cluster + IscU scaffold protein
ReactionCard
[2Fe-1S] desulfurated iron-sulfur cluster+IscS with bound sulfur+IscU scaffold protein4 Thumb+IscS sulfur acceptor protein+IscU with bound [2Fe-2S] cluster
[2Fe-1S] desulfurated iron-sulfur cluster + IscS with bound sulfur + IscU scaffold protein → 4 Hydrogen ion + IscS sulfur acceptor protein + IscU with bound [2Fe-2S] cluster
ReactionCard
Thumb+2 Thumb+2 IscS with bound sulfur+IscU scaffold proteinThumb+6 Thumb+2 IscS sulfur acceptor protein+IscU with bound [2Fe-2S] cluster
FADH2 + 2 Iron + 2 IscS with bound sulfur + IscU scaffold protein → FAD + 6 Hydrogen ion + 2 IscS sulfur acceptor protein + IscU with bound [2Fe-2S] cluster
ReactionCard
Thumb+2 Thumb+2 IscS with bound sulfur+IscU with bound [2Fe-2S] clusterThumb+6 Thumb+2 IscS sulfur acceptor protein+IscU with two bound [2Fe-2S] clusters
FADH2 + 2 Iron + 2 IscS with bound sulfur + IscU with bound [2Fe-2S] cluster → FAD + 6 Hydrogen ion + 2 IscS sulfur acceptor protein + IscU with two bound [2Fe-2S] clusters
ReactionCard
Thumb+2 Thumb+IscU with two bound [2Fe-2S] clustersThumb+IscU with bound [4Fe-4S] cluster
FADH2 + 2 Hydrogen ion + IscU with two bound [2Fe-2S] clusters → FAD + IscU with bound [4Fe-4S] cluster
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB01248FADMetaboCard
ECMDB01197FADH2MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00692IronMetaboCard
GO Classification:
Function
binding
cation binding
ion binding
iron ion binding
iron-sulfur cluster binding
metal cluster binding
metal ion binding
protein binding
transition metal ion binding
Process
biosynthetic process
cellular biosynthetic process
cofactor biosynthetic process
iron-sulfur cluster assembly
metabolic process
metallo-sulfur cluster assembly
Gene Properties
Blattner:b2529
Gene OrientationCounterclockwise
Centisome Percentage:57.29
Left Sequence End2657925
Right Sequence End2658311
Gene Sequence:
>387 bp
ATGGGCCTGATGTGGGGATTATTCAGCGTCATTATTGCCTCAGTTGCGCAATTAAGCCTG
GGTTTTGCGGCGAGTCATCTGCCGCCGATGACGCACTTATGGGATTTTATCGCGGCTCTG
TTAGCTTTTGGCCTGGATGCCCGGATACTGTTACTCGGGCTGCTGGGTTATCTGCTTTCC
GTTTTTTGTTGGTATAAAACGCTTCATAAACTTGCGCTAAGCAAAGCCTATGCCTTGCTC
AGTATGAGTTATGTGCTGGTATGGATTGCTTCAATGGTACTTCCCGGCTGGGAAGGGACT
TTTTCGCTGAAAGCACTACTGGGAGTAGCCTGTATTATGAGCGGGTTGATGCTGATTTTC
CTGCCCACGACAAAACAACGTTACTGA
Protein Properties
Pfam Domain Function:
Protein Residues:128
Protein Molecular Weight:13848
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>NifU-like protein
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK
References
External Links:
ResourceLink
Uniprot ID:P0ACD4
Uniprot Name:NIFU_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675328
Ecogene ID:EG13395
Ecocyc:EG13395
ColiBase:b2529
Kegg Gene:b2529
EchoBASE ID:EB3176
CCDB:NIFU_ECOLI
BacMap:16130454
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837