Identification
Name:Protoporphyrinogen oxidase
Synonyms:
  • PPO
Gene Name:hemG
Enzyme Class:
Biological Properties
General Function:Involved in FMN binding
Specific Function:Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX. Does not use oxygen directly. Is coupled to the respiratory chain
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+3 Menaquinone+3 ThumbThumb+3 Thumb
Thumb+3 ThumbThumb+3 Thumb
Thumb+3 ThumbThumb+3 Thumb
SMPDB Reactions:
Thumb+3 ThumbThumb+3 Thumb
Thumb+menaquinone-8Thumb+Thumb
Complex Reactions:
1.5 Thumb+Thumb3 Thumb+Thumb
3 Thumb+ThumbThumb+3 Thumb
Metabolites:
ECMDB IDNameView
ECMDB00176Fumaric acidMetaboCard
ECMDB21232Hydrogen peroxideMetaboCard
ECMDB21551Menaquinol 6MetaboCard
ECMDB04102MenaquinoneMetaboCard
ECMDB20441Menaquinone-1MetaboCard
ECMDB04124OxygenMetaboCard
ECMDB00241Protoporphyrin IXMetaboCard
ECMDB01097Protoporphyrinogen IXMetaboCard
ECMDB00254Succinic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
electron carrier activity
FMN binding
nucleotide binding
oxidoreductase activity
Gene Properties
Blattner:b3850
Gene OrientationClockwise
Centisome Percentage:86.92
Left Sequence End4032631
Right Sequence End4033176
Gene Sequence:
>546 bp
ATGGCGCTTAAAGCGACAATTTATAAAGCGACGGTTAATGTGGCCGATCTCGACCGCAAC
CAGTTTCTCGATGCCTCTCTGACGCTGGCGCGCCATCCTTCAGAAACCCAGGAGCGTATG
ATGCTGCGCTTGCTGGCGTGGCTGAAATATGCTGATGAACGTCTGCAATTTACCCGTGGT
TTGTGTGCCGATGATGAGCCGGAAGCGTGGCTGCGTAACGATCACCTGGGCATTGATTTG
TGGATTGAGCTGGGGCTGCCGGATGAGCGGCGGATTAAGAAAGCCTGCACCCAGGCCGCA
GAAGTGGCGCTGTTTACCTATAATAGTCGGGCGGCGCAAATCTGGTGGCAGCAAAATCAG
AGCAAATGTGTGCAGTTTGCCAATCTTTCCGTCTGGTATCTGGACGATGAACAACTGGCG
AAAGTAAGCGCCTTTGCCGATCGTACCATGACGCTGCAGGCAACGATTCAGGATGGCGTG
ATCTGGTTATCGGATGATAAGAATAATCTGGAAGTGAACTTAACCGCCTGGCAACAACCT
TCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:181
Protein Molecular Weight:21226
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Protoporphyrinogen oxidase
MKTLILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQWENYDRVVIGASIRYG
HYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCA
VIAGALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQVANFAREIAHLTDKPTL
K
References
External Links:
ResourceLink
Uniprot ID:P0ACB4
Uniprot Name:HEMG_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674376
Ecogene ID:EG11485
Ecocyc:EG11485
ColiBase:b3850
Kegg Gene:b3850
EchoBASE ID:EB1448
CCDB:HEMG_ECOLI
BacMap:16131696
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Nakahigashi, K., Inokuchi, H. (1990). "Nucleotide sequence between the fadB gene and the rrnA operon from Escherichia coli." Nucleic Acids Res 18:6439. Pubmed: 2243799
  • Nishimura, K., Nakayashiki, T., Inokuchi, H. (1995). "Cloning and identification of the hemG gene encoding protoporphyrinogen oxidase (PPO) of Escherichia coli K-12." DNA Res 2:1-8. Pubmed: 7788523
  • Sasarman, A., Letowski, J., Czaika, G., Ramirez, V., Nead, M. A., Jacobs, J. M., Morais, R. (1993). "Nucleotide sequence of the hemG gene involved in the protoporphyrinogen oxidase activity of Escherichia coli K12." Can J Microbiol 39:1155-1161. Pubmed: 7916647