Canmetcon
Identification
Name:Aspartate ammonia-lyase
Synonyms:
  • Aspartase
Gene Name:aspA
Enzyme Class:
Biological Properties
General Function:Involved in aspartate ammonia-lyase activity
Specific Function:L-aspartate = fumarate + NH(3)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
SMPDB Reactions:
L-Aspartic acid+ThumbThumb+Thumb
L-Aspartic acid+ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB00176Fumaric acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00191L-Aspartic acidMetaboCard
GO Classification:
Function
ammonia-lyase activity
aspartate ammonia-lyase activity
carbon-nitrogen lyase activity
catalytic activity
lyase activity
Process
acetyl-CoA catabolic process
acetyl-CoA metabolic process
aspartate family amino acid metabolic process
aspartate metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
coenzyme metabolic process
cofactor metabolic process
metabolic process
tricarboxylic acid cycle
Gene Properties
Blattner:b4139
Gene OrientationCounterclockwise
Centisome Percentage:94.08
Left Sequence End4364914
Right Sequence End4366350
Gene Sequence:
>1437 bp
ATGACAAGGATAAAAATAAACGCACGCCGTATCTTCAGCTTATTGATTCCTTTTTTCTTT
TTCACTTCTGTTCACGCTGAACAAACGGCTGCTCCCGCAAAACCTGTAACTGTGGAAGCG
AAGAATGAAACCTTTGCCCCGCAGCATCCCGATCAATATCTCTCCTGGAAAGCCACCTCG
GAACAGTCAGAGCGTGTTGACGCCCTGGCGGAAGATCCACGGCTGGTGATCCTGTGGGCG
GGGTATCCCTTCTCGCGCGATTACAACAAGCCGCGTGGACATGCTTTTGCTGTGACCGAT
GTGCGTGAAACCCTGCGTACCGGTGCGCCGAAAAACGCTGAAGATGGTCCGCTACCGATG
GCATGCTGGAGTTGTAAAAGCCCGGATGTGGCGCGTCTGATCCAGAAAGACGGCGAAGAT
GGCTACTTCCACGGTAAATGGGCGCGCGGCGGTCCGGAAATCGTCAACAACTTAGGTTGT
GCCGATTGCCATAACACCGCCTCTCCAGAGTTCGCCAAAGGCAAACCGGAGTTAACCCTT
TCCCGTCCGTATGCGGCTCGCGCGATGGAAGCCATTGGTAAACCTTTTGAGAAAGCCGGA
CGTTTCGACCAGCAATCGATGGTTTGCGGTCAGTGCCATGTGGAGTATTACTTCGACGGC
AAAAACAAAGCGGTTAAATTCCCGTGGGATGACGGCATGAAAGTCGAAAATATGGAGCAG
TATTACGACAAAATTGCCTTCTCTGACTGGACTAACTCCCTGTCGAAAACGCCAATGCTG
AAAGCGCAGCACCCGGAATATGAAACCTGGACAGCGGGCATTCACGGTAAAAACAACGTG
ACCTGTATCGACTGCCATATGCCAAAAGTGCAGAACGCCGAAGGCAAACTCTACACCGAC
CATAAAATTGGTAATCCGTTTGATAACTTCGCCCAGACTTGTGCGAACTGCCATACCCAG
GACAAAGCTGCCTTGCAAAAAGTGGTCGCGGAACGTAAGCAGTCGATTAACGACCTGAAA
ATCAAGGTTGAAGATCAACTGGTTCACGCTCACTTCGAAGCGAAAGCAGCGCTGGATGCA
GGCGCGACGGAAGCTGAAATGAAGCCAATTCAGGACGATATCCGTCATGCCCAGTGGCGC
TGGGATCTGGCGATCGCTTCCCACGGCATTCATATGCACGCACCGGAAGAAGGTTTACGG
ATGCTCGGTACGGCGATGGATAAAGCGGCGGATGCACGCACCAAACTGGCGCGCCTGCTG
GCGACCAAAGGCATCACCCATGAAATCCAGATCCCGGATATCTCAACCAAAGAGAAAGCC
CAGCAGGCCATTGGCCTGAACATGGAACAAATCAAGGCCGAGAAGCAGGACTTCATCAAA
ACGGTGATCCCGCAGTGGGAAGAACAGGCACGTAAAAACGGTCTGTTAAGCCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:478
Protein Molecular Weight:52356
Protein Theoretical pI:5
PDB File:1JSW
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Aspartate ammonia-lyase
MSNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIPEFVRGMVMVKKAAAM
ANKELQTIPKSVANAIIAACDEVLNNGKCMDQFPVDVYQGGAGTSVNMNTNEVLANIGLE
LMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVE
FQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGATAIGTGLN
TPKEYSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRL
LSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQ
LNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKEVCEGYVYNSIGIVTYLNPFIG
HHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFSVQNLMHPAYKAKRYTDESEQ
References
External Links:
ResourceLink
Uniprot ID:P0AC38
Uniprot Name:ASPA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676822
PDB ID:1JSW
Ecogene ID:EG10095
Ecocyc:EG10095
ColiBase:b4139
Kegg Gene:b4139
EchoBASE ID:EB0093
CCDB:ASPA_ECOLI
BacMap:90111690
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jayasekera, M. M., Shi, W., Farber, G. K., Viola, R. E. (1997). "Evaluation of functionally important amino acids in L-aspartate ammonia-lyase from Escherichia coli." Biochemistry 36:9145-9150. Pubmed: 9230046
  • Saribas, A. S., Schindler, J. F., Viola, R. E. (1994). "Mutagenic investigation of conserved functional amino acids in Escherichia coli L-aspartase." J Biol Chem 269:6313-6319. Pubmed: 8119980
  • Shi, W., Dunbar, J., Jayasekera, M. M., Viola, R. E., Farber, G. K. (1997). "The structure of L-aspartate ammonia-lyase from Escherichia coli." Biochemistry 36:9136-9144. Pubmed: 9230045
  • Takagi, J. S., Ida, N., Tokushige, M., Sakamoto, H., Shimura, Y. (1985). "Cloning and nucleotide sequence of the aspartase gene of Escherichia coli W." Nucleic Acids Res 13:2063-2074. Pubmed: 2987841
  • Woods, S. A., Miles, J. S., Roberts, R. E., Guest, J. R. (1986). "Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12." Biochem J 237:547-557. Pubmed: 3541901