Identification
Name:Fumarate hydratase class I, aerobic
Synonyms:
  • Fumarase
Gene Name:fumA
Enzyme Class:
Biological Properties
General Function:Involved in lyase activity
Specific Function:It functions as an aerobic enzyme in the citric acid cycle. It accounts for about 80% of the fumarase activity when the bacteria grows aerobically
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb
ThumbThumb+Thumb
SMPDB Reactions:
Thumb+ThumbL-Malic acid+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00176Fumaric acidMetaboCard
ECMDB00156L-Malic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
carbon-oxygen lyase activity
catalytic activity
fumarate hydratase activity
hydro-lyase activity
lyase activity
Process
cellular metabolic process
generation of precursor metabolites and energy
metabolic process
Gene Properties
Blattner:b1612
Gene OrientationCounterclockwise
Centisome Percentage:36.31
Left Sequence End1684755
Right Sequence End1686401
Gene Sequence:
>1647 bp
ATGTCAAACAAACCCTTTCATTATCAGGCTCCTTTTCCACTCAAAAAAGATGATACTGAG
TATTACCTGCTAACCAGCGAACACGTTAGCGTATCTGAATTTGAAGGGCAGGAGATTTTG
AAAGTCGCACCCGAAGCGTTAACTCTGTTGGCGCGCCAGGCGTTTCATGATGCGTCGTTC
ATGCTGCGTCCGGCGCACCAACAACAGGTGGCCGACATTCTGCGTGACCCGGAGGCCAGC
GAAAATGATAAATATGTGGCGCTGCAATTCCTGCGTAACTCCGACATCGCGGCGAAAGGC
GTTCTGCCAACCTGTCAGGATACCGGCACCGCGATTATTGTTGGTAAAAAAGGGCAGCGT
GTATGGACCGGTGGTGGTGATGAAGCGGCGCTGGCGCGCGGTGTCTATAACACTTATATC
GAAGATAATCTGCGCTACTCGCAAAACGCGCCGCTGGATATGTATAAAGAAGTGAATACC
GGCACCAATCTGCCAGCGCAGATCGATCTTTATGCCGTTGATGGCGACGAATACAAATTC
CTCTGTATCGCCAAAGGTGGTGGTTCGGCAAACAAGACGTATCTCTATCAGGAAACCAAA
GCGTTACTGACGCCGGGGAAACTGAAAAATTACCTGGTTGAGAAGATGCGCACGCTGGGT
ACGGCGGCCTGTCCTCCGTATCATATTGCGTTCGTTATTGGTGGAACTTCTGCAGAAACG
AACCTTAAAACGGTGAAACTGGCTTCCGCGAAATACTATGATGAACTGCCAACGGAAGGG
AATGAGCACGGTCAGGCGTTCCGCGATGTGGAACTGGAAAAAGAATTGCTGATCGAAGCG
CAAAATCTTGGTCTGGGTGCGCAGTTTGGTGGTAAATACTTCGCTCACGACATCCGCGTG
ATTCGCCTGCCACGTCACGGCGCATCCTGCCCGGTCGGTATGGGCGTCTCCTGCTCTGCT
GACCGTAATATCAAAGCGAAGATCAACCGTCAGGGGATCTGGATCGAAAAACTGGAACAT
AATCCAGGCAAATATATCCCGGAAGAGCTGCGCAAAGCGGGAGAAGGCGAAGCGGTGCGC
GTTGACCTTAACCGTCCGATGAAAGAGATCCTCGCACAGTTGTCGCAGTATCCCGTTTCT
ACACGCTTATCGCTTAACGGCACGATTATCGTCGGTCGTGATATTGCTCACGCCAAACTG
AAAGAGCGGATGGATAACGGTGAAGGGCTGCCGCAGTACATCAAAGATCATCCGATTTAC
TACGCGGGTCCGGCCAAAACGCCGGAAGGTTATGCCTCCGGTTCTCTTGGCCCAACGACC
GCCGGACGGATGGATTCTTATGTCGATCAACTGCAAGCGCAGGGCGGAAGTATGATCATG
CTGGCGAAAGGCAACCGCAGCCAGCAGGTGACGGATGCCTGTAAAAAACACGGCGGCTTC
TACCTTGGCAGTATCGGTGGTCCGGCCGCTGTATTGGCGCAGGGAAGTATTAAGAGCCTG
GAATGTGTTGAATATCCGGAACTGGGAATGGAAGCCATCTGGAAAATTGAAGTGGAAGAT
TTCCCGGCGTTTATCCTTGTGGATGATAAAGGAAATGACTTCTTCCAGCAGATACAACTC
ACACAATGCACCCGCTGTGTGAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:548
Protein Molecular Weight:60298
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Fumarate hydratase class I, aerobic
MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASF
MLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQR
VWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKF
LCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAET
NLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRV
IRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVR
VDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIY
YAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGF
YLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQL
TQCTRCVK
References
External Links:
ResourceLink
Uniprot ID:P0AC33
Uniprot Name:FUMA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1742662
Ecogene ID:EG10356
Ecocyc:EG10356
ColiBase:b1612
Kegg Gene:b1612
EchoBASE ID:EB0351
CCDB:FUMA_ECOLI
BacMap:16129570
General Reference:
  • Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kasai, H., Kashimoto, K., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Horiuchi, T., et, a. l. .. (1996). "A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map." DNA Res 3:363-377. Pubmed: 9097039
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Guest, J. R., Miles, J. S., Roberts, R. E., Woods, S. A. (1985). "The fumarase genes of Escherichia coli: location of the fumB gene and discovery of a new gene (fumC)." J Gen Microbiol 131:2971-2984. Pubmed: 3005475
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Miles, J. S., Guest, J. R. (1984). "Complete nucleotide sequence of the fumarase gene fumA, of Escherichia coli." Nucleic Acids Res 12:3631-3642. Pubmed: 6328431
  • Ueda, Y., Yumoto, N., Tokushige, M., Fukui, K., Ohya-Nishiguchi, H. (1991). "Purification and characterization of two types of fumarase from Escherichia coli." J Biochem 109:728-733. Pubmed: 1917897
  • Woods, S. A., Schwartzbach, S. D., Guest, J. R. (1988). "Two biochemically distinct classes of fumarase in Escherichia coli." Biochim Biophys Acta 954:14-26. Pubmed: 3282546