Canmetcon
Identification
Name:Anaerobic C4-dicarboxylate transporter dcuA
Synonyms:Not Available
Gene Name:dcuA
Enzyme Class:Not Available
Biological Properties
General Function:Involved in C4-dicarboxylate transmembrane transporter activity
Specific Function:Responsible for the transport of C4-dicarboxylates from the periplasm across the inner membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:
Transports:
Transport References:
  • Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB00176Fumaric acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00191L-Aspartic acidMetaboCard
ECMDB00156L-Malic acidMetaboCard
ECMDB00254Succinic acidMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
C4-dicarboxylate transmembrane transporter activity
carboxylic acid transmembrane transporter activity
dicarboxylic acid transmembrane transporter activity
organic acid transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
C4-dicarboxylate transport
carboxylic acid transport
dicarboxylic acid transport
establishment of localization
organic acid transport
transport
Gene Properties
Blattner:b4138
Gene OrientationCounterclockwise
Centisome Percentage:94.05
Left Sequence End4363495
Right Sequence End4364796
Gene Sequence:
>1302 bp
ATGTTCAATTTTGCAGTCAGCCGCGAAAGCCTGTTATCAGGATTTCAGTGGTTTTTCTTT
ATTTTTTGCAACACGGTTGTGGTTCCTCCTACGCTACTTTCTGCTTTTCAGTTGCCGCAA
AGTAGCCTGCTTACGCTCACGCAATATGCTTTTCTTGCTACCGCACTGGCCTGCTTCGCT
CAGGCGTTTTGCGGTCATCGTCGCGCTATTATGGAAGGGCCAGGTGGCCTGTGGTGGGGA
ACCATCCTTACTATCACCCTTGGTGAAGCATCGCGCGGGACACCGATCAACGATATCGCC
ACCAGCCTGGCAGTGGGGATTGCACTCTCCGGCGTGCTGACGATGTTGATTGGTTTTAGC
GGATTAGGCCATCGCCTGGCACGGTTATTTACGCCGTCGGTGATGGTCTTGTTTATGTTG
ATGCTGGGCGCGCAGCTGACCACTATCTTTTTCAAAGGTATGCTCGGGCTGCCGTTTGGC
ATAGCCGACCCGAATTTTAAAATTCAGTTACCGCCGTTCGCGCTCTCGGTGGCGGTGATG
TGCCTGGTACTGGCGATGATTATCTTCCTGCCGCAACGTTTTGCCCGTTATGGCCTGCTG
GTCGGCACCATAACCGGCTGGTTGTTGTGGTACTTTTGCTTTCCTTCTTCGCACTCGCTC
TCCGGTGAGTTGCACTGGCAGTGGTTCCCGCTCGGCAGTGGCGGTGCTTTGTCGCCGGGA
ATTATTCTGACGGCGGTGATTACAGGTCTGGTAAATATCAGCAATACCTACGGTGCGATT
CGGGGCACGGATGTTTTTTATCCGCAGCAGGGCGCAGGGAATACGCGTTATCGTCGTAGC
TTTGTGGCGACCGGATTTATGACGCTGATAACCGTACCGCTGGCGGTAATTCCATTTTCA
CCGTTTGTTTCATCCATTGGTTTATTAACCCAGACTGGCGATTACACGCGGCGTTCGTTT
ATTTATGGCAGCGTTATTTGCCTGCTGGTGGCGCTGGTTCCTGCACTCACGCGACTGTTT
TGCAGTATCCCTTTACCCGTGAGTAGTGCGGTCATGCTGGTTTCTTATCTGCCTTTACTC
TTTTCCGCGCTGGTGTTTAGCCAGCAAATAACGTTTACCGCTCGCAATATTTATCGACTC
GCATTGCCGTTATTTGTCGGCATATTTTTAATGGCATTACCGCCTGTGTATCTGCAAGAC
CTTCCATTAACGCTTCGTCCTCTGCTCAGTAACGGCTTATTGGTCGGGATTTTACTGGCT
GTTCTTATGGATAACCTTATTCCGTGGGAACGCATCGAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:433
Protein Molecular Weight:45750
Protein Theoretical pI:8
Signaling Regions:
  • None
Transmembrane Regions:
  • 1-18
  • 20-37
  • 54-71
  • 86-103
  • 133-147
  • 229-246
  • 265-282
  • 293-310
  • 333-350
  • 356-373
Protein Sequence:
>Anaerobic C4-dicarboxylate transporter dcuA
MLVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNIPFDVISIIMAVIAAI
SAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAK
EQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYLHLLSVVIPSTLLAVL
VMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSGAKTSVWLFLLGVVGVVIY
AIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDTDNILNSSTFKAGMSACICI
LGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALA
LNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVAL
AVCFGFVLGSFML
References
External Links:
ResourceLink
Uniprot ID:P0ABN5
Uniprot Name:DCUA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674651
Ecogene ID:EG11225
Ecocyc:EG11225
ColiBase:b4138
Kegg Gene:b4138
CCDB:DCUA_ECOLI
BacMap:16131963
General Reference:
  • Bell, P. J., Andrews, S. C., Sivak, M. N., Guest, J. R. (1989). "Nucleotide sequence of the FNR-regulated fumarase gene (fumB) of Escherichia coli K-12." J Bacteriol 171:3494-3503. Pubmed: 2656658
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Golby, P., Kelly, D. J., Guest, J. R., Andrews, S. C. (1998). "Topological analysis of DcuA, an anaerobic C4-dicarboxylate transporter of Escherichia coli." J Bacteriol 180:4821-4827. Pubmed: 9733683
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Six, S., Andrews, S. C., Roberts, R. E., Unden, G., Guest, J. R. (1993). "Construction and properties of Escherichia coli mutants defective in two genes encoding homologous membrane proteins with putative roles in anaerobic C4-dicarboxylic acid transport." Biochem Soc Trans 21:342S. Pubmed: 8131924
  • Six, S., Andrews, S. C., Unden, G., Guest, J. R. (1994). "Escherichia coli possesses two homologous anaerobic C4-dicarboxylate membrane transporters (DcuA and DcuB) distinct from the aerobic dicarboxylate transport system (Dct)." J Bacteriol 176:6470-6478. Pubmed: 7961398
  • Takagi, J. S., Ida, N., Tokushige, M., Sakamoto, H., Shimura, Y. (1985). "Cloning and nucleotide sequence of the aspartase gene of Escherichia coli W." Nucleic Acids Res 13:2063-2074. Pubmed: 2987841
  • Woods, S. A., Miles, J. S., Roberts, R. E., Guest, J. R. (1986). "Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12." Biochem J 237:547-557. Pubmed: 3541901