Canmetcon
Identification
Name:Cytochrome c-type protein nrfB
Synonyms:Not Available
Gene Name:nrfB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in heme binding
Specific Function:Plays a role in nitrite reduction
Cellular Location:Periplasm (Potential)
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
3 Thumb+2 Thumb+Thumb3 Thumb+2 Thumb+Thumb
3 Thumb+2 Thumb+Thumb3 Menaquinone 8+2 Thumb+Thumb
3 Menaquinol 8 + 2 Hydrogen ion + Nitrite → 3 Menaquinone 8 + 2 Water + Ammonium
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB02786NitriteMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b4071
Gene OrientationClockwise
Centisome Percentage:92.40
Left Sequence End4287268
Right Sequence End4287834
Gene Sequence:
>567 bp
ATGAATATCACTGCTACTGTTCTTCTTGCGTTTGGTATGTCGATGGATGCATTTGCTGCA
TCAATCGGTAAAGGTGCCACCCTCCATAAACCGAAATTTTCTGAAGCATTGCGAACCGGC
CTTATTTTTGGTGCCGTCGAAACCCTGACGCCGCTGATCGGCTGGGGAATGGGCATGTTA
GCCAGCCGGTTTGTCCTTGAATGGAACCACTGGATTGCGTTTGTGCTGCTGATATTCCTC
GGCGGGCGAATGATTATTGAGGGTTTTCGTGGCGCAGATGATGAAGATGAAGAGCCGCGC
CGTCGACACGGTTTCTGGCTACTGGTAACCACCGCGATTGCCACCAGCCTGGATGCCATG
GCTGTGGGTGTTGGTCTTGCTTTCCTGCAGGTCAACATTATCGCGACCGCATTGGCCATT
GGTTGTGCAACCTTGATTATGTCAACATTAGGGATGATGGTTGGTCGCTTTATCGGCTCA
ATTATTGGGAAAAAAGCGGAAATTCTCGGCGGGCTGGTGCTGATCGGCATCGGCGTCCAG
ATCCTCTGGACGCACTTCCACGGTTAA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:188
Protein Molecular Weight:20714
Protein Theoretical pI:7
Signaling Regions:
  • 1-32
Transmembrane Regions:
  • None
Protein Sequence:
>Cytochrome c-type protein nrfB
MSVLRSLLTAGVLASGLLWSLNGITATPAAQASDDRYEVTQQRNPDAACLDCHKPDTEGM
HGKHASVINPNNKLPVTCTNCHGQPSPQHREGVKDVMRFNEPMYKVGEQNSVCMSCHLPE
QLQKAFWPHDVHVTKVACASCHSLHPQQDTMQTLSDKGRIKICVDCHSDQRTNPNFNPAS
VPLLKEQP
References
External Links:
ResourceLink
Uniprot ID:P0ABL1
Uniprot Name:NRFB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85675134
Ecogene ID:EG11945
Ecocyc:EG11945
ColiBase:b4071
Kegg Gene:b4071
EchoBASE ID:EB1888
CCDB:NRFB_ECOLI
BacMap:90111682
General Reference:
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hussain, H., Grove, J., Griffiths, L., Busby, S., Cole, J. (1994). "A seven-gene operon essential for formate-dependent nitrite reduction to ammonia by enteric bacteria." Mol Microbiol 12:153-163. Pubmed: 8057835
  • Iobbi-Nivol, C., Crooke, H., Griffiths, L., Grove, J., Hussain, H., Pommier, J., Mejean, V., Cole, J. A. (1994). "A reassessment of the range of c-type cytochromes synthesized by Escherichia coli K-12." FEMS Microbiol Lett 119:89-94. Pubmed: 8039676