Canmetcon
Identification
Name:Cytochrome c-552
Synonyms:
  • Ammonia-forming cytochrome c nitrite reductase
  • Cytochrome c nitrite reductase
Gene Name:nrfA
Enzyme Class:
Biological Properties
General Function:Involved in nitrogen compound metabolic process
Specific Function:Plays a role in nitrite reduction
Cellular Location:Periplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+2 Thumb+6 Ferricytochrome c+ThumbThumb+6 Ferrocytochrome c+6 Thumb+Thumb
Ammonia + 2 Water + 6 Ferricytochrome c + Ferricytochrome cNitrite + 6 Ferrocytochrome c + 6 Hydrogen ion + Ferrocytochrome c
ReactionCard
SMPDB Reactions:
Nitrite+6 ferrocytochrome c+7 Thumb+Thumb+6 ThumbThumb+6 ferricytochrome c+2 Thumb+6 Thumb
Nitrite + 6 ferrocytochrome c + 7 Hydrogen ion + Nitrite + 6 Ferrocytochrome cAmmonia + 6 ferricytochrome c + 2 Water + 6 Ferricytochrome c
ReactionCard
Complex Reactions:
3 Thumb+2 Thumb+Thumb3 Thumb+2 Thumb+Thumb
3 Thumb+2 Thumb+Thumb3 Menaquinone 8+2 Thumb+Thumb
3 Menaquinol 8 + 2 Hydrogen ion + Nitrite → 3 Menaquinone 8 + 2 Water + Ammonium
ReactionCard
Thumb+2 Thumb+6 ThumbThumb+6 Thumb+7 Thumb
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21652Ferricytochrome cMetaboCard
ECMDB23135Ferrocytochrome cMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB02786NitriteMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
periplasmic space
Function
binding
calcium ion binding
catalytic activity
cation binding
heme binding
ion binding
iron ion binding
metal ion binding
nitrite reductase (cytochrome, ammonia-forming) activity
oxidoreductase activity
oxidoreductase activity, acting on other nitrogenous compounds as donors
oxidoreductase activity, acting on other nitrogenous compounds as donors, cytochrome as acceptor
transition metal ion binding
Process
metabolic process
nitrogen compound metabolic process
oxidation reduction
Gene Properties
Blattner:b4070
Gene OrientationClockwise
Centisome Percentage:92.37
Left Sequence End4285787
Right Sequence End4287223
Gene Sequence:
>1437 bp
ATGACAAGGATAAAAATAAACGCACGCCGTATCTTCAGCTTATTGATTCCTTTTTTCTTT
TTCACTTCTGTTCACGCTGAACAAACGGCTGCTCCCGCAAAACCTGTAACTGTGGAAGCG
AAGAATGAAACCTTTGCCCCGCAGCATCCCGATCAATATCTCTCCTGGAAAGCCACCTCG
GAACAGTCAGAGCGTGTTGACGCCCTGGCGGAAGATCCACGGCTGGTGATCCTGTGGGCG
GGGTATCCCTTCTCGCGCGATTACAACAAGCCGCGTGGACATGCTTTTGCTGTGACCGAT
GTGCGTGAAACCCTGCGTACCGGTGCGCCGAAAAACGCTGAAGATGGTCCGCTACCGATG
GCATGCTGGAGTTGTAAAAGCCCGGATGTGGCGCGTCTGATCCAGAAAGACGGCGAAGAT
GGCTACTTCCACGGTAAATGGGCGCGCGGCGGTCCGGAAATCGTCAACAACTTAGGTTGT
GCCGATTGCCATAACACCGCCTCTCCAGAGTTCGCCAAAGGCAAACCGGAGTTAACCCTT
TCCCGTCCGTATGCGGCTCGCGCGATGGAAGCCATTGGTAAACCTTTTGAGAAAGCCGGA
CGTTTCGACCAGCAATCGATGGTTTGCGGTCAGTGCCATGTGGAGTATTACTTCGACGGC
AAAAACAAAGCGGTTAAATTCCCGTGGGATGACGGCATGAAAGTCGAAAATATGGAGCAG
TATTACGACAAAATTGCCTTCTCTGACTGGACTAACTCCCTGTCGAAAACGCCAATGCTG
AAAGCGCAGCACCCGGAATATGAAACCTGGACAGCGGGCATTCACGGTAAAAACAACGTG
ACCTGTATCGACTGCCATATGCCAAAAGTGCAGAACGCCGAAGGCAAACTCTACACCGAC
CATAAAATTGGTAATCCGTTTGATAACTTCGCCCAGACTTGTGCGAACTGCCATACCCAG
GACAAAGCTGCCTTGCAAAAAGTGGTCGCGGAACGTAAGCAGTCGATTAACGACCTGAAA
ATCAAGGTTGAAGATCAACTGGTTCACGCTCACTTCGAAGCGAAAGCAGCGCTGGATGCA
GGCGCGACGGAAGCTGAAATGAAGCCAATTCAGGACGATATCCGTCATGCCCAGTGGCGC
TGGGATCTGGCGATCGCTTCCCACGGCATTCATATGCACGCACCGGAAGAAGGTTTACGG
ATGCTCGGTACGGCGATGGATAAAGCGGCGGATGCACGCACCAAACTGGCGCGCCTGCTG
GCGACCAAAGGCATCACCCATGAAATCCAGATCCCGGATATCTCAACCAAAGAGAAAGCC
CAGCAGGCCATTGGCCTGAACATGGAACAAATCAAGGCCGAGAAGCAGGACTTCATCAAA
ACGGTGATCCCGCAGTGGGAAGAACAGGCACGTAAAAACGGTCTGTTAAGCCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:478
Protein Molecular Weight:53703
Protein Theoretical pI:7
PDB File:1GU6
Signaling Regions:
  • 1-26
Transmembrane Regions:
  • None
Protein Sequence:
>Cytochrome c-552
MTRIKINARRIFSLLIPFFFFTSVHAEQTAAPAKPVTVEAKNETFAPQHPDQYLSWKATS
EQSERVDALAEDPRLVILWAGYPFSRDYNKPRGHAFAVTDVRETLRTGAPKNAEDGPLPM
ACWSCKSPDVARLIQKDGEDGYFHGKWARGGPEIVNNLGCADCHNTASPEFAKGKPELTL
SRPYAARAMEAIGKPFEKAGRFDQQSMVCGQCHVEYYFDGKNKAVKFPWDDGMKVENMEQ
YYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGKNNVTCIDCHMPKVQNAEGKLYTD
HKIGNPFDNFAQTCANCHTQDKAALQKVVAERKQSINDLKIKVEDQLVHAHFEAKAALDA
GATEAEMKPIQDDIRHAQWRWDLAIASHGIHMHAPEEGLRMLGTAMDKAADARTKLARLL
ATKGITHEIQIPDISTKEKAQQAIGLNMEQIKAEKQDFIKTVIPQWEEQARKNGLLSQ
References
External Links:
ResourceLink
Uniprot ID:P0ABK9
Uniprot Name:NRFA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676822
PDB ID:1GU6
Ecogene ID:EG11781
Ecocyc:EG11781
ColiBase:b4070
Kegg Gene:b4070
EchoBASE ID:EB1729
CCDB:NRFA_ECOLI
BacMap:16131896
General Reference:
  • Bamford, V. A., Angove, H. C., Seward, H. E., Thomson, A. J., Cole, J. A., Butt, J. N., Hemmings, A. M., Richardson, D. J. (2002). "Structure and spectroscopy of the periplasmic cytochrome c nitrite reductase from Escherichia coli." Biochemistry 41:2921-2931. Pubmed: 11863430
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Darwin, A., Hussain, H., Griffiths, L., Grove, J., Sambongi, Y., Busby, S., Cole, J. (1993). "Regulation and sequence of the structural gene for cytochrome c552 from Escherichia coli: not a hexahaem but a 50 kDa tetrahaem nitrite reductase." Mol Microbiol 9:1255-1265. Pubmed: 7934939
  • Eaves, D. J., Grove, J., Staudenmann, W., James, P., Poole, R. K., White, S. A., Griffiths, I., Cole, J. A. (1998). "Involvement of products of the nrfEFG genes in the covalent attachment of haem c to a novel cysteine-lysine motif in the cytochrome c552 nitrite reductase from Escherichia coli." Mol Microbiol 28:205-216. Pubmed: 9593308
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Iobbi-Nivol, C., Crooke, H., Griffiths, L., Grove, J., Hussain, H., Pommier, J., Mejean, V., Cole, J. A. (1994). "A reassessment of the range of c-type cytochromes synthesized by Escherichia coli K-12." FEMS Microbiol Lett 119:89-94. Pubmed: 8039676