ATP synthase subunit a (P0AB98)

Identification
Name:ATP synthase subunit a
Synonyms:
  • ATP synthase F0 sector subunit a
  • F-ATPase subunit 6
Gene Name:atpB
Enzyme Class:Not Available
Biological Properties
General Function:Involved in hydrogen ion transmembrane transporter activity
Specific Function:Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
  • Oxidative phosphorylation PW000919
  • purine nucleotides de novo biosynthesis PW000910
  • purine nucleotides de novo biosynthesis 1435709748 PW000960
  • purine nucleotides de novo biosynthesis 2 PW002033
KEGG Pathways:
SMPDB Reactions:
1.0Adenosine diphosphate+1.0Thumb+4.0Thumb+1.0Thumb ↔ 1.0Thumb+3.0Thumb+1.0Thumb
1.0Adenosine diphosphate + 1.0Phosphate + 4.0Hydrogen ion + 1.0ADP ↔ 1.0Water + 3.0Hydrogen ion + 1.0Adenosine triphosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
macromolecular complex
protein complex
proton-transporting ATP synthase complex, coupling factor F(o)
proton-transporting two-sector ATPase complex, proton-transporting domain
Function
cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
ATP biosynthetic process
ATP synthesis coupled proton transport
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleoside triphosphate biosynthetic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
purine ribonucleoside triphosphate biosynthetic process
Gene Properties
Blattner:b3738
Gene OrientationCounterclockwise
Centisome Percentage:84.47
Left Sequence End3919259
Right Sequence End3920074
Gene Sequence:
>816 bp
ATGCAGTATTGGGGAAAAATCATTGGCGTGGCCGTGGCCTTACTGATGGGCGGCGGCTTT
TGGGGCGTAGTGTTAGGCCTGTTAATTGGCCATATGTTTGATAAAGCCCGTAGCCGTAAA
ATGGCGTGGTTCGCCAACCAGCGTGAGCGTCAGGCGCTGTTTTTTGCCACCACTTTTGAA
GTGATGGGGCATTTAACCAAATCCAAAGGTCGCGTCACGGAGGCTGATATTCATATCGCC
AGCCAGTTGATGGACCGAATGAATCTTCATGGCGCTTCCCGTACTGCGGCGCAAAATGCG
TTCCGGGTGGGAAAATCAGACAATTACCCGCTGCGCGAAAAGATGCGCCAGTTTCGCAGT
GTCTGCTTTGGTCGTTTTGACTTAATTCGTATGTTTCTGGAGATCCAGATTCAGGCGGCG
TTTGCTGATGGTTCACTGCACCCGAATGAACGGGCGGTGCTGTATGTCATTGCAGAAGAA
TTAGGGATCTCCCGCGCTCAGTTTGACCAGTTTTTGCGCATGATGCAGGGCGGTGCACAG
TTTGGCGGCGGTTATCAGCAGCAAACTGGCGGTGGTAACTGGCAGCAAGCGCAGCGTGGC
CCAACGCTGGAAGATGCCTGTAATGTGCTGGGCGTGAAGCCGACGGATGATGCGACCACC
ATCAAACGTGCCTACCGTAAGCTGATGAGTGAACACCATCCCGATAAGCTGGTGGCGAAA
GGTTTGCCGCCTGAGATGATGGAGATGGCGAAGCAGAAAGCGCAGGAAATTCAGCAGGCA
TATGAGCTGATAAAGCAGCAGAAAGGGTTTAAATGA
Protein Properties
Pfam Domain Function:
Protein Residues:271
Protein Molecular Weight:30303
Protein Theoretical pI:7
PDB File:1C17
Signaling Regions:
  • None
Transmembrane Regions:
  • 40-60
  • 100-120
  • 146-166
  • 220-240
  • 242-262
Protein Sequence:
>ATP synthase subunit a
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLF
RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL
LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL
QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP
WAIFHILIITLQAFIFMVLTIVYLSMASEEH
References
External Links:
ResourceLink
Uniprot ID:P0AB98
Uniprot Name:ATP6_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321936
PDB ID:1C17
Ecogene ID:EG10099
Ecocyc:EG10099
ColiBase:b3738
Kegg Gene:b3738
EchoBASE ID:EB0097
CCDB:ATP6_ECOLI
BacMap:16131606
General Reference:
  • Bjorbaek, C., Foersom, V., Michelsen, O. (1990). "The transmembrane topology of the a [corrected] subunit from the ATPase in Escherichia coli analyzed by PhoA protein fusions." FEBS Lett 260:31-34. Pubmed: 2137094
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Cain, B. D., Simoni, R. D. (1986). "Impaired proton conductivity resulting from mutations in the a subunit of F1F0 ATPase in Escherichia coli." J Biol Chem 261:10043-10050. Pubmed: 2874137
  • Cain, B. D., Simoni, R. D. (1989). "Proton translocation by the F1F0ATPase of Escherichia coli. Mutagenic analysis of the a subunit." J Biol Chem 264:3292-3300. Pubmed: 2536742
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Gay, N. J., Walker, J. E. (1981). "The atp operon: nucleotide sequence of the promoter and the genes for the membrane proteins, and the delta subunit of Escherichia coli ATP-synthase." Nucleic Acids Res 9:3919-3926. Pubmed: 6272190
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kanazawa, H., Futai, M. (1982). "Structure and function of H+-ATPase: what we have learned from Escherichia coli H+-ATPase." Ann N Y Acad Sci 402:45-64. Pubmed: 6301339
  • Kanazawa, H., Kiyasu, T., Noumi, T., Futai, M. (1984). "Overproduction of subunit a of the F0 component of proton-translocating ATPase inhibits growth of Escherichia coli cells." J Bacteriol 158:300-306. Pubmed: 6325392
  • Kanazawa, H., Mabuchi, K., Kayano, T., Noumi, T., Sekiya, T., Futai, M. (1981). "Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits." Biochem Biophys Res Commun 103:613-620. Pubmed: 6277311
  • Kumamoto, C. A., Simoni, R. D. (1986). "Genetic evidence for interaction between the a and b subunits of the F0 portion of the Escherichia coli proton translocating ATPase." J Biol Chem 261:10037-10042. Pubmed: 2874136
  • Lewis, M. J., Chang, J. A., Simoni, R. D. (1990). "A topological analysis of subunit alpha from Escherichia coli F1F0-ATP synthase predicts eight transmembrane segments." J Biol Chem 265:10541-10550. Pubmed: 2162353
  • Nielsen, J., Hansen, F. G., Hoppe, J., Friedl, P., von Meyenburg, K. (1981). "The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli." Mol Gen Genet 184:33-39. Pubmed: 6278247
  • Nielsen, J., Jorgensen, B. B., van Meyenburg, K. V., Hansen, F. G. (1984). "The promoters of the atp operon of Escherichia coli K12." Mol Gen Genet 193:64-71. Pubmed: 6318052
  • Rastogi, V. K., Girvin, M. E. (1999). "Structural changes linked to proton translocation by subunit c of the ATP synthase." Nature 402:263-268. Pubmed: 10580496
  • Valiyaveetil, F. I., Fillingame, R. H. (1998). "Transmembrane topography of subunit a in the Escherichia coli F1F0 ATP synthase." J Biol Chem 273:16241-16247. Pubmed: 9632683
  • Vik, S. B., Lee, D., Marshall, P. A. (1991). "Temperature-sensitive mutations at the carboxy terminus of the alpha subunit of the Escherichia coli F1F0 ATP synthase." J Bacteriol 173:4544-4548. Pubmed: 1829729
  • Walker, J. E., Gay, N. J., Saraste, M., Eberle, A. N. (1984). "DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS." Biochem J 224:799-815. Pubmed: 6395859
  • Yamada, H., Moriyama, Y., Maeda, M., Futai, M. (1996). "Transmembrane topology of Escherichia coli H(+)-ATPase (ATP synthase) subunit a." FEBS Lett 390:34-38. Pubmed: 8706824