Canmetcon
Identification
Name:Protein nrfC
Synonyms:Not Available
Gene Name:nrfC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in electron carrier activity
Specific Function:Probably involved in the transfer of electrons from the quinone pool to the type-c cytochromes
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
3 Thumb+2 Thumb+Thumb3 Thumb+2 Thumb+Thumb
3 Thumb+2 Thumb+Thumb3 Menaquinone 8+2 Thumb+Thumb
3 Menaquinol 8 + 2 Hydrogen ion + Nitrite → 3 Menaquinone 8 + 2 Water + Ammonium
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB02786NitriteMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
electron carrier activity
iron-sulfur cluster binding
metal cluster binding
Gene Properties
Blattner:b4072
Gene OrientationClockwise
Centisome Percentage:92.42
Left Sequence End4287831
Right Sequence End4288502
Gene Sequence:
>672 bp
ATGACCTGGTCTCGTCGCCAGTTTCTCACCGGCGTCGGCGTGCTGGCAGCCGTCAGCGGC
ACCGCAGGGCGCGTGGTGGCGAAAACGTTGAATATCAATGGGGTGCGTTACGGCATGGTG
CATGACGAGTCGTTATGCATCGGCTGTACCGCCTGTATGGATGCTTGTCGGGAAGTGAAC
AAGGTGCCGGAAGGCGTCTCGCGCCTGACGATTATTCGTAGCGAGCCGCAGGGCGAATTT
CCTGATGTGAAATATCGCTTCTTCCGTAAGTCTTGCCAGCACTGCGATCATGCGCCGTGC
GTTGACGTCTGCCCGACCGGTGCGTCTTTTCGCGATGCTGCCAGTGGGATTGTCGATGTT
AATCCGGATCTCTGCGTCGGTTGTCAGTACTGCATCGCCGCCTGTCCGTACCGCGTGCGC
TTTATCCATCCGGTCACGAAGACGGCGGACAAATGCGATTTCTGCCGTAAGACCAATTTG
CAGGCCGGTAAGTTGCCCGCGTGCGTTGAAGCTTGCCCGACCAAGGCGCTGACGTTTGGC
AATCTGGACGATCCCAACAGTGAGATTTCGCAACTGCTGCGCCAGAAGCCCACTTACCGC
TACAAGCTGGCGCTGGGAACCAAACCGAAGCTGTACCGCGTACCGTTTAAATACGGGGAG
GTGAGCCAATGA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:223
Protein Molecular Weight:24567
Protein Theoretical pI:9
Signaling Regions:
  • 1-27
Transmembrane Regions:
  • None
Protein Sequence:
>Protein nrfC
MTWSRRQFLTGVGVLAAVSGTAGRVVAKTLNINGVRYGMVHDESLCIGCTACMDACREVN
KVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDV
NPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLQAGKLPACVEACPTKALTFG
NLDDPNSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVSQ
References
External Links:
ResourceLink
Uniprot ID:P0AAK7
Uniprot Name:NRFC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676824
Ecogene ID:EG11946
Ecocyc:EG11946
ColiBase:b4072
Kegg Gene:b4072
EchoBASE ID:EB1889
CCDB:NRFC_ECOLI
BacMap:16131898
General Reference:
  • Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Hussain, H., Grove, J., Griffiths, L., Busby, S., Cole, J. (1994). "A seven-gene operon essential for formate-dependent nitrite reduction to ammonia by enteric bacteria." Mol Microbiol 12:153-163. Pubmed: 8057835
  • Tullman-Ercek, D., DeLisa, M. P., Kawarasaki, Y., Iranpour, P., Ribnicky, B., Palmer, T., Georgiou, G. (2007). "Export pathway selectivity of Escherichia coli twin arginine translocation signal peptides." J Biol Chem 282:8309-8316. Pubmed: 17218314