Identification
Name:Hypoxanthine phosphoribosyltransferase
Synonyms:
  • HPRT
Gene Name:hpt
Enzyme Class:
Biological Properties
General Function:Involved in hypoxanthine phosphoribosyltransferase activity
Specific Function:This enzyme acts exclusively on hypoxanthine; it does not act on guanine
Cellular Location:Cytoplasm
SMPDB Pathways:Not Available
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
6-Mercaptopurine+Thumb6-Thioinosine-5'-monophosphate+Thumb
6-Mercaptopurine + Phosphoribosyl pyrophosphate ↔ 6-Thioinosine-5'-monophosphate + Pyrophosphate
ReactionCard
6-Methylmercaptopurine+Thumb6-Methylthiopurine 5'-monophosphate ribonucleotide+Thumb
6-Methylmercaptopurine + Phosphoribosyl pyrophosphate ↔ 6-Methylthiopurine 5'-monophosphate ribonucleotide + Pyrophosphate
ReactionCard
Thioguanine+Thumb6-Thioguanosine monophosphate+Thumb
Thioguanine + Phosphoribosyl pyrophosphate ↔ 6-Thioguanosine monophosphate + Pyrophosphate
ReactionCard
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Complex Reactions:
Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00034AdenineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00132GuanineMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB00157HypoxanthineMetaboCard
ECMDB04085Inosinic acidMetaboCard
ECMDB00280Phosphoribosyl pyrophosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
ECMDB00292XanthineMetaboCard
ECMDB01554Xanthylic acidMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
catalytic activity
hypoxanthine phosphoribosyltransferase activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
Process
biosynthetic process
cellular biosynthetic process
cellular nitrogen compound metabolic process
heterocycle biosynthetic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside metabolic process
purine ribonucleoside salvage
purine salvage
Gene Properties
Blattner:b0125
Gene OrientationClockwise
Centisome Percentage:3.05
Left Sequence End141431
Right Sequence End141967
Gene Sequence:
>537 bp
ATGAAACATACTGTAGAAGTAATGATCCCCGAAGCGGAGATTAAAGCGCGTATCGCCGAA
CTGGGTCGTCAGATTACTGAGCGTTACAAAGACAGCGGCAGCGATATGGTGCTGGTGGGT
CTGCTGCGTGGCTCATTTATGTTTATGGCGGACCTGTGCCGTGAAGTTCAGGTATCTCAT
GAAGTCGACTTTATGACCGCCTCCAGCTACGGTAGCGGCATGTCCACCACCCGTGATGTG
AAAATCCTCAAAGATCTGGATGAAGATATCCGTGGCAAGGACGTGCTGATTGTTGAAGAT
ATCATCGACTCGGGGAATACACTGTCGAAAGTGCGTGAGATCTTAAGCCTGCGCGAACCG
AAGTCGCTGGCGATTTGTACGCTGCTGGATAAACCGTCCCGTCGTGAAGTGAACGTCCCG
GTAGAATTTATCGGTTTCTCGATCCCGGATGAGTTTGTGGTGGGTTACGGCATTGATTAC
GCACAGCGTTACCGTCATCTGCCGTATATCGGCAAAGTGATTCTGCTGGACGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:178
Protein Molecular Weight:20115
Protein Theoretical pI:5
PDB File:1GRV
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Hypoxanthine phosphoribosyltransferase
MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGSFMFMADLCREVQVSH
EVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREP
KSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQRYRHLPYIGKVILLDE
References
External Links:
ResourceLink
Uniprot ID:P0A9M2
Uniprot Name:HPRT_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674341
PDB ID:1GRV
Ecogene ID:EG20098
Ecocyc:EG20098
ColiBase:b0125
Kegg Gene:b0125
EchoBASE ID:EB4143
CCDB:HPRT_ECOLI
BacMap:90111088
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Fujita, N., Mori, H., Yura, T., Ishihama, A. (1994). "Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region." Nucleic Acids Res 22:1637-1639. Pubmed: 8202364
  • Guddat, L. W., Vos, S., Martin, J. L., Keough, D. T., de Jersey, J. (2002). "Crystal structures of free, IMP-, and GMP-bound Escherichia coli hypoxanthine phosphoribosyltransferase." Protein Sci 11:1626-1638. Pubmed: 12070315
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553