Canmetcon
Identification
Name:Nitrite reductase [NAD(P)H] small subunit
Synonyms:Not Available
Gene Name:nirD
Enzyme Class:
Biological Properties
General Function:Involved in nitrite reductase [NAD(P)H] activity
Specific Function:Required for activity of the reductase
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+3 Thumb+2 ThumbThumb+Thumb+3 Thumb+5 Thumb
SMPDB Reactions:
Nitrite+3 Thumb+5 Thumb+Thumb ? Thumb+2 Thumb+3 Thumb
Complex Reactions:
5 Thumb+3 Thumb+Thumb2 Thumb+3 Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB02786NitriteMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
2 iron, 2 sulfur cluster binding
binding
catalytic activity
iron-sulfur cluster binding
metal cluster binding
nitrite reductase [NAD(P)H] activity
oxidoreductase activity
oxidoreductase activity, acting on other nitrogenous compounds as donors
oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
Process
metabolic process
nitrate assimilation
nitrate metabolic process
nitrogen compound metabolic process
oxidation reduction
Gene Properties
Blattner:b3366
Gene OrientationClockwise
Centisome Percentage:75.32
Left Sequence End3494573
Right Sequence End3494899
Gene Sequence:
>327 bp
ATGAAAAAACTGATTCTCATCGCCATAATGGCATCGGGGCTGGTAGCTTGTGCGCAATCA
ACCGCGCCACAGGAAGACAGTCGTCTGAAAGAGGCATACAGCGCCTGTATCAACACCGCA
CAAGGTTCGCCAGAAAAAATTGAAGCCTGCCAGAGCGTGTTAAACGTGCTGAAGAAAGAG
AAACAACATCAGCAGTTTGCCGACCAGGAAAGTGTACGCGTACTGGATTATCAGCAGTGT
CTGCGTGCAACGCAAACCGGAAATGATCAGGCGGTGAAAGCCGATTGTGATAAAGTCTGG
CAGGAAATACGCAGTAATAACAAATAA
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:108
Protein Molecular Weight:12284
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Nitrite reductase [NAD(P)H] small subunit
MSQWKDICKIDDILPETGVCALLGDEQVAIFRPYHSDQVFAISNIDPFFESSVLSRGLIA
EHQGELWVASPLKKQRFRLSDGLCMEDEQFSVKHYEARVKDGVVQLRG
References
External Links:
ResourceLink
Uniprot ID:P0A9I8
Uniprot Name:NIRD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062283
Ecogene ID:EG10655
Ecocyc:EG10655
ColiBase:b3366
Kegg Gene:b3366
EchoBASE ID:EB0649
CCDB:NIRD_ECOLI
BacMap:16131245
General Reference:
  • Bell, A. I., Gaston, K. L., Cole, J. A., Busby, S. J. (1989). "Cloning of binding sequences for the Escherichia coli transcription activators, FNR and CRP: location of bases involved in discrimination between FNR and CRP." Nucleic Acids Res 17:3865-3874. Pubmed: 2543955
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Harborne, N. R., Griffiths, L., Busby, S. J., Cole, J. A. (1992). "Transcriptional control, translation and function of the products of the five open reading frames of the Escherichia coli nir operon." Mol Microbiol 6:2805-2813. Pubmed: 1435259
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Peakman, T., Crouzet, J., Mayaux, J. F., Busby, S., Mohan, S., Harborne, N., Wootton, J., Nicolson, R., Cole, J. (1990). "Nucleotide sequence, organisation and structural analysis of the products of genes in the nirB-cysG region of the Escherichia coli K-12 chromosome." Eur J Biochem 191:315-323. Pubmed: 2200672