Identification
Name:Citrate lyase subunit beta
Synonyms:
  • Citrase beta chain
  • Citrate (pro-3S)-lyase subunit beta
  • Citryl-CoA lyase subunit
Gene Name:citE
Enzyme Class:
Biological Properties
General Function:Involved in carbon-carbon lyase activity
Specific Function:Represents a citryl-ACP lyase
Cellular Location:Cytoplasm
SMPDB Pathways:Not Available
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB23162(3S)-Citryl-CoAMetaboCard
ECMDB00042Acetic acidMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB00094Citric acidMetaboCard
ECMDB00223Oxalacetic acidMetaboCard
GO Classification:
Component
cell part
citrate lyase complex
cytoplasm
intracellular part
macromolecular complex
protein complex
Function
carbon-carbon lyase activity
catalytic activity
citrate (pro-3S)-lyase activity
citryl-CoA lyase activity
lyase activity
oxo-acid-lyase activity
Process
acetyl-CoA metabolic process
cellular aromatic compound metabolic process
cellular metabolic process
coenzyme metabolic process
cofactor metabolic process
metabolic process
Gene Properties
Blattner:b0616
Gene OrientationCounterclockwise
Centisome Percentage:13.98
Left Sequence End648805
Right Sequence End649713
Gene Sequence:
>909 bp
GTGCGTATAGGTATCGATTTAGGCGGCACCAAAACTGAAGTGATTGCACTGGGCGATGCA
GGGGAGCAGTTGTACCGCCATCGTCTGCCCACGCCGCGTGATGATTACCGGCAGACTATT
GAAACGATCGCCACGTTGGTTGATATGGCGGAGCAGGCGACGGGGCAGCGCGGAACGGTA
GGTATGGGCATTCCTGGCTCAATTTCGCCTTACACCGGTGTGGTGAAGAATGCCAATTCA
ACCTGGCTCAACGGTCAGCCATTCGATAAAGACTTAAGCGCGAGGTTGCAGCGGGAAGTG
CGGCTGGCAAATGACGCTAACTGTCTGGCGGTTTCAGAAGCAGTAGATGGCGCGGCAGCG
GGAGCGCAGACGGTATTTGCCGTGATTATCGGCACGGGATGCGGCGCGGGCGTGGCATTC
AATGGGCGGGCGCATATCGGCGGCAATGGCACGGCAGGTGAGTGGGGACACAATCCGCTA
CCGTGGATGGACGAAGACGAACTGCGTTATCGCGAGGAAGTCCCTTGTTATTGCGGTAAA
CAAGGTTGTATTGAAACCTTTATTTCGGGCACGGGATTCGCGATGGATTATCGTCGTTTG
AGCGGACATGCGCTGAAAGGCAGTGAAATTATCCGCCTGGTTGAAGAAAGCGATCCGGTA
GCGGAACTGGCATTGCGTCGCTACGAGCTGCGGCTGGCAAAATCGCTGGCACATGTCGTG
AATATTCTCGATCCGGATGTGATTGTCCTGGGGGGCGGGATGAGCAATGTAGACCGTTTA
TATCAAACGGTTGGGCAGTTGATTAAACAATTTGTCTTCGGCGGCGAATGTGAAACGCCG
GTGCGTAAGGCGAAGCACGGTGATTCCAGCGGCGTACGCGGCGCTGCGTGGTTATGGCCA
CAAGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:302
Protein Molecular Weight:33109
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Citrate lyase subunit beta
MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDTARRMVY
HALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPKTDTAQDVLDIEKEILR
IEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGT
ELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIDLL
HNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDGPVIDRARLVLSRAELSGIR
EE
References
External Links:
ResourceLink
Uniprot ID:P0A9I1
Uniprot Name:CITE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674535
Ecogene ID:EG13542
Ecocyc:EG13542
ColiBase:b0616
Kegg Gene:b0616
EchoBASE ID:EB3312
CCDB:CITE_ECOLI
BacMap:90111153
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232