Identification
Name:5'-nucleotidase yjjG
Synonyms:
  • Nucleoside 5'-monophosphate phosphohydrolase
Gene Name:yjjG
Enzyme Class:
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Nucleotidase that shows high phosphatase activity toward three nucleoside 5'-monophosphates, UMP, dUMP, and dTMP, and very low activity against TDP, IMP, UDP, GMP, dGMP, AMP, dAMP, and 6- phosphogluconate. Is strictly specific to substrates with 5'- phosphates and shows no activity against nucleoside 2'- or 3'- monophosphates. Might be involved in the pyrimidine nucleotide substrate cycles
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
5'-Ribonucleotide+ThumbThumb+Thumb
5'-Ribonucleotide + WaterRibonucleoside + Phosphate
ReactionCard
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
a ribonucleoside monophosphate+Thumba ribonucleoside+Thumb
a ribonucleoside monophosphate + Water → a ribonucleoside + Phosphate
ReactionCard
Complex Reactions:
Thumb+ThumbThumb+Thumb
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB010442'-Deoxyguanosine 5'-monophosphateMetaboCard
ECMDB012275-Thymidylic acidMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00095Cytidine monophosphateMetaboCard
ECMDB01202dCMPMetaboCard
ECMDB00101DeoxyadenosineMetaboCard
ECMDB00905Deoxyadenosine monophosphateMetaboCard
ECMDB00014DeoxycytidineMetaboCard
ECMDB00085DeoxyguanosineMetaboCard
ECMDB00012DeoxyuridineMetaboCard
ECMDB01409dUMPMetaboCard
ECMDB00133GuanosineMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB00195InosineMetaboCard
ECMDB04085Inosinic acidMetaboCard
ECMDB00855Nicotinamide ribosideMetaboCard
ECMDB00229Nicotinamide ribotideMetaboCard
ECMDB23222NMNMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00273ThymidineMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00288Uridine 5'-monophosphateMetaboCard
ECMDB00494WaterMetaboCard
ECMDB00299XanthosineMetaboCard
ECMDB01554Xanthylic acidMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphatase activity
phosphoglycolate phosphatase activity
phosphoric ester hydrolase activity
Process
metabolic process
Gene Properties
Blattner:b4374
Gene OrientationClockwise
Centisome Percentage:99.29
Left Sequence End4606669
Right Sequence End4607346
Gene Sequence:
>678 bp
ATGAGTGCGTCGTTGGCGATCCTGACCATCGGCATTGTACCTATGCAGGAAGTTTTGCCG
CTCCTGACGGAATACATTGACGAAGATAATATTTCCCATCATAGCCTGCTGGGGAAGTTA
AGTCGTGAAGAAGTGATGGCGGAGTACGCGCCAGAAGCAGGCGAAGACACCATTCTCACA
TTATTAAATGACAACCAGCTGGCCCATGTTTCGCGTCGCAAAGTGGAGCGTGACCTGCAA
GGTGTGGTTGAAGTGCTCGATAATCAGGGTTATGACGTCATTTTATTAATGAGTACAGCA
AACATTAGTAGTATGACTGCGCGTAATACGATCTTTCTTGAGCCGTCGCGAATATTGCCT
CCACTGGTTTCCTCTATTGTTGAAGATCATCAGGTGGGGGTTATCGTTCCGGTTGAGGAG
ATGCTGCCCGTTCAGGCGCAAAAATGGCAAATTTTGCAGAAATCGCCGGTATTTTCATTG
GGTAACCCCATTCATGATTCAGAACAAAAAATCATTGATGCCGGGAAAGAATTACTGGCA
AAAGGGGCTGATGTCATCATGCTGGATTGTTTAGGATTTCACCAACGTCATCGCGATTTA
CTGCAAAAACAGCTCGATGTTCCTGTCTTGCTGTCTAACGTATTGATTGCACGGCTGGCT
GCGGAATTACTGGTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:225
Protein Molecular Weight:25300
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>5'-nucleotidase yjjG
MKWDWIFFDADETLFTFDSFTGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITS
LQLQHGRFESWAERLNVEPGKLNEAFINAMAEICTPLPGAVSLLNAIRGNAKIGIITNGF
SALQQVRLERTGLRDYFDLLVISEEVGVAKPNKKIFDYALEQAGNPDRSRVLMVGDTAES
DILGGINAGLATCWLNAHHREQPEGIAPTWTVSSLHELEQLLCKH
References
External Links:
ResourceLink
Uniprot ID:P0A8Y1
Uniprot Name:YJJG_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674531
Ecogene ID:EG12115
Ecocyc:EG12115
ColiBase:b4374
Kegg Gene:b4374
EchoBASE ID:EB2038
CCDB:YJJG_ECOLI
BacMap:16132192
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Proudfoot, M., Kuznetsova, E., Brown, G., Rao, N. N., Kitagawa, M., Mori, H., Savchenko, A., Yakunin, A. F. (2004). "General enzymatic screens identify three new nucleotidases in Escherichia coli. Biochemical characterization of SurE, YfbR, and YjjG." J Biol Chem 279:54687-54694. Pubmed: 15489502