Identification
Name:Multifunctional protein surE
Synonyms:
  • Stationary-phase survival protein surE
  • 5'/3'-nucleotidase
  • Nucleoside monophosphate phosphohydrolase
  • Exopolyphosphatase
Gene Name:surE
Enzyme Class:
Biological Properties
General Function:Involved in hydrolase activity
Specific Function:Nucleotidase with a broad substrate specificity as it can dephosphorylate various ribo- and deoxyribonucleoside 5'- monophosphates and ribonucleoside 3'-monophosphates with highest affinity to 3'-AMP. Also hydrolyzes polyphosphate (exopolyphosphatase activity) with the preference for short-chain- length substrates (P20-25). Might be involved in the regulation of dNTP and NTP pools, and in the turnover of 3'-mononucleotides produced by numerous intracellular RNases (T1, T2, and F) during the degradation of various RNAs. Also plays a significant physiological role in stress-response and is required for the survival of E.coli in stationary growth phase
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
5'-Ribonucleotide+ThumbThumb+Thumb
5'-Ribonucleotide + WaterRibonucleoside + Phosphate
ReactionCard
EcoCyc Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+2 Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
a nucleoside 3'-phosphate+Thumba ribonucleoside+Thumb
a nucleoside 3'-phosphate + Water → a ribonucleoside + Phosphate
ReactionCard
a ribonucleoside monophosphate+Thumba ribonucleoside+Thumb
a ribonucleoside monophosphate + Water → a ribonucleoside + Phosphate
ReactionCard
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb+Thumb
A 3'-ribonucleotide+Thumba ribonucleoside+Thumb
A 3'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
(Polyphosphate)(n)+Thumb(polyphosphate)(n-1)+Thumb
(Polyphosphate)(n) + Water → (polyphosphate)(n-1) + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 3'-ribonucleotide+Thumba ribonucleoside+Thumb
A 3'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
(Polyphosphate)(n)+Thumb(polyphosphate)(n-1)+Thumb
(Polyphosphate)(n) + Water → (polyphosphate)(n-1) + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
A 5'-ribonucleotide+Thumba ribonucleoside+Thumb
A 5'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB010442'-Deoxyguanosine 5'-monophosphateMetaboCard
ECMDB012275-Thymidylic acidMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00095Cytidine monophosphateMetaboCard
ECMDB01202dCMPMetaboCard
ECMDB00101DeoxyadenosineMetaboCard
ECMDB00905Deoxyadenosine monophosphateMetaboCard
ECMDB00014DeoxycytidineMetaboCard
ECMDB00085DeoxyguanosineMetaboCard
ECMDB00071DeoxyinosineMetaboCard
ECMDB00012DeoxyuridineMetaboCard
ECMDB06555DIMPMetaboCard
ECMDB01409dUMPMetaboCard
ECMDB00133GuanosineMetaboCard
ECMDB01397Guanosine monophosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB00195InosineMetaboCard
ECMDB04085Inosinic acidMetaboCard
ECMDB00855Nicotinamide ribosideMetaboCard
ECMDB00229Nicotinamide ribotideMetaboCard
ECMDB23222NMNMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
ECMDB00273ThymidineMetaboCard
ECMDB03379TriphosphateMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00288Uridine 5'-monophosphateMetaboCard
ECMDB00494WaterMetaboCard
ECMDB00299XanthosineMetaboCard
ECMDB01554Xanthylic acidMetaboCard
GO Classification:
Function
catalytic activity
hydrolase activity
Gene Properties
Blattner:b2744
Gene OrientationCounterclockwise
Centisome Percentage:61.80
Left Sequence End2867535
Right Sequence End2868296
Gene Sequence:
>762 bp
GTGATGTTGTCTGCTACTCAACCACTTAGCGAAAAATTGCCAGCGCATGGCTGCCGTCAT
GTTGCGATCATTATGGACGGCAATGGCCGCTGGGCAAAAAAGCAAGGGAAGATTCGTGCC
TTTGGGCATAAAGCCGGGGCAAAATCCGTCCGCCGGGCTGTCTCTTTTGCGGCCAACAAC
GGTATTGAGGCGTTAACGCTGTATGCCTTTAGTAGTGAAAACTGGAACCGACCAGCGCAG
GAAGTCAGTGCGTTAATGGAACTGTTTGTGTGGGCGCTCGATAGCGAAGTAAAAAGTCTG
CACCGACATAACGTGCGTCTGCGTATTATTGGCGATACCAGTCGCTTTAACTCGCGTTTG
CAAGAACGTATTCGTAAATCTGAAGCGCTAACAGCCGGGAATACCGGTCTGACGCTGAAT
ATTGCGGCGAACTACGGTGGACGTTGGGATATAGTCCAGGGAGTCAGGCAACTGGCTGAA
AAGGTGCAGCAAGGAAACCTGCAACCAGATCAGATAGATGAAGAGATGCTAAACCAGCAT
GTCTGTATGCATGAACTGGCCCCTGTAGATTTAGTAATTAGGACTGGGGGGGAGCATCGC
ATTAGTAACTTTTTGCTTTGGCAAATTGCCTATGCCGAACTTTACTTTACAGATGTTCTC
TGGCCCGATTTCGATGAACAAGACTTTGAAGGGGCGTTAAATGCCTTTGCTAATCGAGAG
CGTCGTTTCGGCGGCACCGAGCCCGGTGATGAAACAGCCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:253
Protein Molecular Weight:26900
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Multifunctional protein surE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
References
External Links:
ResourceLink
Uniprot ID:P0A840
Uniprot Name:SURE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674367
Ecogene ID:EG11817
Ecocyc:EG11817
ColiBase:b2744
Kegg Gene:b2744
EchoBASE ID:EB1764
CCDB:SURE_ECOLI
BacMap:16130651
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Li, C., Ichikawa, J. K., Ravetto, J. J., Kuo, H. C., Fu, J. C., Clarke, S. (1994). "A new gene involved in stationary-phase survival located at 59 minutes on the Escherichia coli chromosome." J Bacteriol 176:6015-6022. Pubmed: 7928962
  • Proudfoot, M., Kuznetsova, E., Brown, G., Rao, N. N., Kitagawa, M., Mori, H., Savchenko, A., Yakunin, A. F. (2004). "General enzymatic screens identify three new nucleotidases in Escherichia coli. Biochemical characterization of SurE, YfbR, and YjjG." J Biol Chem 279:54687-54694. Pubmed: 15489502