Identification
Name:S-adenosylmethionine:tRNA ribosyltransferase-isomerase
Synonyms:
  • Queuosine biosynthesis protein queA
Gene Name:queA
Enzyme Class:
Biological Properties
General Function:Translation, ribosomal structure and biogenesis
Specific Function:Transfers and isomerizes the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to give epoxyqueuosine (oQ-tRNA)
Cellular Location:Cytoplasm (Potential)
SMPDB Pathways:
KEGG Pathways:Not Available
SMPDB Reactions:
7-aminomethyl-7-deazaguanosine34 in tRNA+S-adenosyl-L-methionineThumb+Thumb+Thumb+Thumb
7-aminomethyl-7-deazaguanosine34 in tRNA + S-adenosyl-L-methionine → Hydrogen ion + L-Methionine + Adenine + epoxyqueuosine
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB232107-Aminomethyl-7-deazaguanosineMetaboCard
ECMDB00034AdenineMetaboCard
ECMDB23186epoxyqueuosineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00696L-MethionineMetaboCard
GO Classification:
Function
catalytic activity
isomerase activity
transferase activity
Process
cellular macromolecule metabolic process
macromolecule metabolic process
metabolic process
ncRNA metabolic process
queuosine biosynthetic process
RNA metabolic process
tRNA metabolic process
tRNA modification
tRNA processing
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1071 bp
ATGCGCGTTACCGATTTCTCCTTTGAATTGCCCGAATCCCTGATTGCCCACTATCCCATG
CCTGAACGCAGTAGCTGTCGTTTACTGTCGCTGGACGGGCCGACGGGCGCGCTGACGCAC
GGTACTTTCACCGATTTACTTGATAAGCTCAACCCCGGCGATCTTCTGGTTTTTAATAAT
ACCCGCGTGATCCCGGCGCGCCTGTTTGGGCGTAAAGCCAGCGGCGGCAAGATTGAAGTG
CTGGTTGAACGGATGCTCGACGACAAACGCATTCTTGCGCATATTCGCGCCTCGAAAGCG
CCAAAACCTGGCGCAGAACTGCTGCTGGGCGATGACGAAAGTATTAACGCAACAATGACC
GCGCGCCACGGCGCACTGTTTGAAGTCGAATTTAATGATGAACGCTCGGTGCTGGATATT
CTCAACAGCATCGGCCATATGCCGCTGCCGCCGTATATCGACCGTCCGGACGAAGACGCT
GACCGCGAACTTTATCAAACCGTTTATAGCGAAAAACCGGGCGCGGTTGCAGCCCCGACC
GCAGGTCTGCATTTTGACGAGCCTTTGCTGGAAAAATTGCGCGCCAAAGGCGTGGAGATG
GCGTTTGTGACGTTGCACGTTGGTGCGGGCACCTTCCAGCCGGTGCGCGTCGACACCATT
GAAGATCACATCATGCACTCGGAATACGCTGAAGTACCGCAGGATGTGGTAGACGCGGTA
CTGGCGGCGAAAGCGCGCGGTAACCGGGTGATTGCGGTTGGCACCACTTCAGTACGTTCG
CTGGAAAGCGCGGCTCAGGCAGCGAAAAACGATCTCATTGAACCGTTCTTCGACGATACC
CAAATCTTTATCTATCCGGGCTTCCAGTACAAAGTGGTCGATGCGCTGGTGACGAACTTC
CACTTGCCAGAGTCGACGCTGATTATGCTGGTTTCGGCCTTTGCCGGTTATCAACACACC
ATGAACGCCTATAAAGCAGCGGTAGAAGAGAAATATCGCTTTTTTAGTTACGGTGATGCG
ATGTTTATCACGTACAATCCGCAGGCAATTAATGAGCGCGTCGGGGAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:356
Protein Molecular Weight:39430
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>S-adenosylmethionine:tRNA ribosyltransferase-isomerase
MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTDLLDKLNPGDLLVFNN
TRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPGAELLLGDDESINATMT
ARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRELYQTVYSEKPGAVAAPT
AGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIEDHIMHSEYAEVPQDVVDAV
LAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQIFIYPGFQYKVVDALVTNF
HLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDAMFITYNPQAINERVGE
References
External Links:
ResourceLink
Uniprot ID:P0A7F9
Uniprot Name:QUEA_ECOLI
GenBank Gene ID:M37702
Genebank Protein ID:147485
CCDB:QUEA_ECOLI
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Reuter, K., Slany, R., Ullrich, F., Kersten, H. (1991). "Structure and organization of Escherichia coli genes involved in biosynthesis of the deazaguanine derivative queuine, a nutrient factor for eukaryotes." J Bacteriol 173:2256-2264. Pubmed: 1706703
  • Slany, R. K., Bosl, M., Crain, P. F., Kersten, H. (1993). "A new function of S-adenosylmethionine: the ribosyl moiety of AdoMet is the precursor of the cyclopentenediol moiety of the tRNA wobble base queuine." Biochemistry 32:7811-7817. Pubmed: 8347586
  • Slany, R. K., Bosl, M., Kersten, H. (1994). "Transfer and isomerization of the ribose moiety of AdoMet during the biosynthesis of queuosine tRNAs, a new unique reaction catalyzed by the QueA protein from Escherichia coli." Biochimie 76:389-393. Pubmed: 7849103
  • Van Lanen, S. G., Iwata-Reuyl, D. (2003). "Kinetic mechanism of the tRNA-modifying enzyme S-adenosylmethionine:tRNA ribosyltransferase-isomerase (QueA)." Biochemistry 42:5312-5320. Pubmed: 12731872