Canmetcon
Identification
Name:Glycine cleavage system H protein
Synonyms:Not Available
Gene Name:gcvH
Enzyme Class:Not Available
Biological Properties
General Function:Amino acid transport and metabolism
Specific Function:The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Glycine, serine and threonine metabolism ec00260
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb+Thumb
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB013545,10-Methylene-THFMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB00123GlycineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB01846Tetrahydrofolic acidMetaboCard
GO Classification:
Component
glycine cleavage complex
intracellular membrane-bounded organelle
macromolecular complex
membrane-bounded organelle
mitochondrion
organelle
protein complex
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
glycine catabolic process
glycine decarboxylation via glycine cleavage system
glycine metabolic process
metabolic process
serine family amino acid metabolic process
Gene Properties
Blattner:b2904
Gene OrientationCounterclockwise
Centisome Percentage:65.68
Left Sequence End3047182
Right Sequence End3047571
Gene Sequence:
>390 bp
ATGAAAAAGCTGCAAATTGCGGTAGGTATTATTCGCAACGAGAACAATGAAATCTTTATA
ACGCGTCGCGCAGCAGATGCGCACATGGCGAATAAACTGGAGTTTCCCGGCGGTAAAATT
GAAATGGGTGAAACGCCGGAACAGGCGGTGGTGCGTGAACTTCAGGAAGAAGTCGGGATT
ACCCCCCAACATTTTTCGCTATTTGAAAAACTGGAATATGAATTCCCGGACAGGCATATA
ACACTGTGGTTTTGGCTGGTCGAACGCTGGGAAGGGGAGCCGTGGGGTAAAGAAGGGCAA
CCCGGTGAGTGGATGTCGCTGGTCGGTCTTAATGCCGATGATTTTCCGCCAGCCAATGAA
CCGGTAATTGCGAAGCTTAAACGTCTGTAG
Protein Properties
Pfam Domain Function:
Protein Residues:129
Protein Molecular Weight:13811
Protein Theoretical pI:4
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Glycine cleavage system H protein
MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAV
AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDAT
AYEALLEDE
References
External Links:
ResourceLink
Uniprot ID:P0A6T9
Uniprot Name:GCSH_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321980
Ecogene ID:EG10371
Ecocyc:EG10371
ColiBase:b2904
Kegg Gene:b2904
EchoBASE ID:EB0366
CCDB:GCSH_ECOLI
BacMap:16130806
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Okamura-Ikeda, K., Ohmura, Y., Fujiwara, K., Motokawa, Y. (1993). "Cloning and nucleotide sequence of the gcv operon encoding the Escherichia coli glycine-cleavage system." Eur J Biochem 216:539-548. Pubmed: 8375392
  • Stauffer, L. T., Fogarty, S. J., Stauffer, G. V. (1994). "Characterization of the Escherichia coli gcv operon." Gene 142:17-22. Pubmed: 8181752
  • Stauffer, L. T., Ghrist, A., Stauffer, G. V. (1993). "The Escherichia coli gcvT gene encoding the T-protein of the glycine cleavage enzyme system." DNA Seq 3:339-346. Pubmed: 8219277
  • Stauffer, L. T., Steiert, P. S., Steiert, J. G., Stauffer, G. V. (1991). "An Escherichia coli protein with homology to the H-protein of the glycine cleavage enzyme complex from pea and chicken liver." DNA Seq 2:13-17. Pubmed: 1802033