Canmetcon
Identification
Name:Nicotinamide-nucleotide amidohydrolase PncC
Synonyms:Not Available
Gene Name:pncC
Enzyme Class:
Biological Properties
General Function:pyridine nucleotide biosynthetic process
Specific Function:Has nicotinamidemononucleotide (NMN) aminohydrolase activity, not active on other substrates.
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
  • Nicotinate and nicotinamide metabolism ec00760
KEGG Reactions:
Thumb+ThumbThumb+Thumb
SMPDB Reactions:
beta-nicotinamide D-ribonucleotide+Thumb+ThumbThumb+nicotinate beta-D-ribonucleotide+Thumb
beta-nicotinamide D-ribonucleotide + Water + NMNAmmonium + nicotinate beta-D-ribonucleotide + Nicotinamide ribotide
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB00229Nicotinamide ribotideMetaboCard
ECMDB23222NMNMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
nicotinamide-nucleotide amidase activity
pyridine nucleotide biosynthetic process
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>498
atgactgacagtgaactgatgcagttaagtgaacaggttgggcaggcgctgaaagcccgt
ggcgcaaccgtaacaactgccgagtcttgtaccggtggttgggtagcgaaagtgattacc
gatattgccggtagctccgcctggtttgaacgcggatttgtcacctacagtaacgaagcc
aaagcgcagatgatcggcgtacgcgaagagacgctggcgcagcatggcgcggtgagtgaa
cccgtcgtggtggaaatggcgataggcgcactgaaagcggctcgtgctgattatgccgtg
tctattagtggtatcgccgggccggatggcggcagtgaagagaagcctgtcggcaccgtc
tggtttgcttttgccactgcccgcggtgaaggcattacccggcgggaatgcttcagcggc
gaccgtgatgcggtgcgtcgtcaggctactgcgtatgcattgcagaccttgtggcaacaa
tttctacaaaacacttga
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:165
Protein Molecular Weight:17581
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Nicotinamide-nucleotide amidohydrolase PncC
MTDSELMQLSEQVGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEA
KAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADYAVSISGIAGPDGGSEEKPVGTV
WFAFATARGEGITRRECFSGDRDAVRRQATAYALQTLWQQFLQNT
References
External Links:
ResourceLink
Uniprot ID:P0A6G3
Uniprot Name:PNCC_ECOLI
CCDB:PNCC_ECOLI
General Reference:Not Available