Canmetcon
Identification
Name:Phosphoenolpyruvate-protein phosphotransferase
Synonyms:
  • Phosphotransferase system, enzyme I
Gene Name:ptsI
Enzyme Class:
Biological Properties
General Function:Involved in transferase activity, transferring phosphorus-containing groups
Specific Function:General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. Enzyme I transfers the phosphoryl group from phosphoenolpyruvate (PEP) to the phosphoryl carrier protein (HPr)
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
  • Phosphotransferase system (PTS) ec02060
Transports:
Transport References:Not Available
KEGG Reactions:
1.0Thumb+1.0Protein histidine1.0Thumb+1.0Protein N(pi)-phospho-L-histidine
1.0Phosphoenolpyruvic acid + 1.0Protein histidine ↔ 1.0Pyruvic acid + 1.0Protein N(pi)-phospho-L-histidine
ReactionCard
EcoCyc Reactions:
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
Complex Reactions:
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
Metabolites:
ECMDB IDNameView
ECMDB200632(alpha-D-Mannosyl)-D-glycerateMetaboCard
ECMDB211352(alpha-D-Mannosyl-6-phosphate)-D-glycerateMetaboCard
ECMDB20117Arbutin 6-phosphateMetaboCard
ECMDB00044Ascorbic acidMetaboCard
ECMDB03556ChitobioseMetaboCard
ECMDB00660D-FructoseMetaboCard
ECMDB00122D-GlucoseMetaboCard
ECMDB00163D-MaltoseMetaboCard
ECMDB00169D-MannoseMetaboCard
ECMDB20547Diacetylchitobiose-6-phosphateMetaboCard
ECMDB01882DihydroxyacetoneMetaboCard
ECMDB01473Dihydroxyacetone phosphateMetaboCard
ECMDB01076Fructose 1-phosphateMetaboCard
ECMDB00124Fructose 6-phosphateMetaboCard
ECMDB00107GalactitolMetaboCard
ECMDB20149Galactitol 1-phosphateMetaboCard
ECMDB01514GlucosamineMetaboCard
ECMDB01254Glucosamine 6-phosphateMetaboCard
ECMDB01401Glucose 6-phosphateMetaboCard
ECMDB20164L-Ascorbate 6-phosphateMetaboCard
ECMDB20171Maltose 6'-phosphateMetaboCard
ECMDB00765MannitolMetaboCard
ECMDB01078Mannose 6-phosphateMetaboCard
ECMDB00215N-Acetyl-D-glucosamineMetaboCard
ECMDB01062N-Acetyl-D-Glucosamine 6-PhosphateMetaboCard
ECMDB01121N-Acetyl-D-mannosamine 6-phosphateMetaboCard
ECMDB20176N-Acetyl-D-muramoateMetaboCard
ECMDB01129N-AcetylmannosamineMetaboCard
ECMDB20177N-Acetylmuramic acid 6-phosphateMetaboCard
ECMDB00263Phosphoenolpyruvic acidMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00247SorbitolMetaboCard
ECMDB01400Sorbitol-6-phosphateMetaboCard
ECMDB00258SucroseMetaboCard
ECMDB20196Sucrose-6-phosphateMetaboCard
ECMDB00975TrehaloseMetaboCard
ECMDB01124Trehalose 6-phosphateMetaboCard
GO Classification:
Component
cell part
cytoplasm
intracellular part
Function
catalytic activity
cation transmembrane transporter activity
cation:sugar symporter activity
ion transmembrane transporter activity
phosphoenolpyruvate-protein phosphotransferase activity
phosphotransferase activity, nitrogenous group as acceptor
solute:cation symporter activity
substrate-specific transmembrane transporter activity
sugar:hydrogen symporter activity
transferase activity
transferase activity, transferring phosphorus-containing groups
transmembrane transporter activity
transporter activity
Process
carbohydrate transport
cellular metabolic process
establishment of localization
metabolic process
phosphate metabolic process
phosphoenolpyruvate-dependent sugar phosphotransferase system
phosphorus metabolic process
phosphorylation
transport
Gene Properties
Blattner:b2416
Gene OrientationClockwise
Centisome Percentage:54.57
Left Sequence End2532088
Right Sequence End2533815
Gene Sequence:
>1728 bp
ATGATTTCAGGCATTTTAGCATCCCCGGGTATCGCTTTCGGTAAAGCTCTGCTTCTGAAA
GAAGACGAAATTGTCATTGACCGGAAAAAAATTTCTGCCGACCAGGTTGATCAGGAAGTT
GAACGTTTTCTGAGCGGTCGTGCCAAGGCATCAGCCCAGCTGGAAACGATCAAAACGAAA
GCTGGTGAAACGTTCGGTGAAGAAAAAGAAGCCATCTTTGAAGGGCATATTATGCTGCTC
GAAGATGAGGAGCTGGAGCAGGAAATCATAGCCCTGATTAAAGATAAGCACATGACAGCT
GACGCAGCTGCTCATGAAGTTATCGAAGGTCAGGCTTCTGCCCTGGAAGAGCTGGATGAT
GAATACCTGAAAGAACGTGCGGCTGACGTACGTGATATCGGTAAGCGCCTGCTGCGCAAC
ATCCTGGGCCTGAAGATTATCGACCTGAGCGCCATTCAGGATGAAGTCATTCTGGTTGCC
GCTGACCTGACGCCGTCCGAAACCGCACAGCTGAACCTGAAGAAGGTGCTGGGTTTCATC
ACCGACGCGGGTGGCCGTACTTCCCACACCTCTATCATGGCGCGTTCTCTGGAACTACCT
GCTATCGTGGGTACCGGTAGCGTCACCTCTCAGGTGAAAAATGACGACTATCTGATTCTG
GATGCCGTAAATAATCAGGTTTACGTCAATCCAACCAACGAAGTTATTGATAAAATGCGC
GCTGTTCAGGAGCAAGTGGCTTCTGAAAAAGCAGAGCTTGCTAAACTGAAAGATCTGCCA
GCTATTACGCTGGACGGTCACCAGGTAGAAGTATGCGCTAACATTGGTACGGTTCGTGAC
GTTGAAGGTGCAGAGCGTAACGGCGCTGAAGGCGTTGGTCTGTATCGTACTGAGTTCCTG
TTCATGGACCGCGACGCACTGCCCACTGAAGAAGAACAGTTTGCTGCTTACAAAGCAGTG
GCTGAAGCGTGTGGCTCGCAAGCGGTTATCGTTCGTACCATGGACATCGGCGGCGACAAA
GAGCTGCCATACATGAACTTCCCGAAAGAAGAGAACCCGTTCCTCGGCTGGCGCGCTATC
CGTATCGCGATGGATCGTAGAGAGATCCTGCGCGATCAGCTCCGCGCTATCCTGCGTGCC
TCGGCTTTCGGTAAATTGCGCATTATGTTCCCGATGATCATCTCTGTTGAAGAAGTGCGT
GCACTGCGCAAAGAGATCGAAATCTACAAACAGGAACTGCGCGACGAAGGTAAAGCGTTT
GACGAGTCAATTGAAATCGGCGTAATGGTGGAAACACCGGCTGCCGCAACAATTGCACGT
CATTTAGCCAAAGAAGTTGATTTCTTTAGTATCGGCACCAATGATTTAACGCAGTACACT
CTGGCAGTTGACCGTGGTAATGATATGATTTCACACCTTTACCAGCCAATGTCACCGTCC
GTGCTGAACTTGATCAAGCAAGTTATTGATGCTTCTCATGCTGAAGGCAAATGGACTGGC
ATGTGTGGTGAGCTTGCTGGCGATGAACGTGCTACACTTCTGTTGCTGGGGATGGGTCTG
GACGAATTCTCTATGAGCGCCATTTCTATCCCGCGCATTAAGAAGATTATCCGTAACACG
AACTTCGAAGATGCGAAGGTGTTAGCAGAGCAGGCTCTTGCTCAACCGACAACGGACGAG
TTAATGACGCTGGTTAACAAGTTCATTGAAGAAAAAACAATCTGCTAA
Protein Properties
Pfam Domain Function:
Protein Residues:575
Protein Molecular Weight:63561
Protein Theoretical pI:5
PDB File:3EZE
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Phosphoenolpyruvate-protein phosphotransferase
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFL
FMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAI
RIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAF
DESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPS
VLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNT
NFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC
References
External Links:
ResourceLink
Uniprot ID:P08839
Uniprot Name:PT1_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1799835
PDB ID:3EZE
Ecogene ID:EG10789
Ecocyc:EG10789
ColiBase:b2416
Kegg Gene:b2416
EchoBASE ID:EB0782
CCDB:PT1_ECOLI
BacMap:16130342
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Byrne, C. R., Monroe, R. S., Ward, K. A., Kredich, N. M. (1988). "DNA sequences of the cysK regions of Salmonella typhimurium and Escherichia coli and linkage of the cysK regions to ptsH." J Bacteriol 170:3150-3157. Pubmed: 3290198
  • De Reuse, H., Danchin, A. (1988). "The ptsH, ptsI, and crr genes of the Escherichia coli phosphoenolpyruvate-dependent phosphotransferase system: a complex operon with several modes of transcription." J Bacteriol 170:3827-3837. Pubmed: 2457575
  • De Reuse, H., Roy, A., Danchin, A. (1985). "Analysis of the ptsH-ptsI-crr region in Escherichia coli K-12: nucleotide sequence of the ptsH gene." Gene 35:199-207. Pubmed: 2411636
  • Garrett, D. S., Seok, Y. J., Liao, D. I., Peterkofsky, A., Gronenborn, A. M., Clore, G. M. (1997). "Solution structure of the 30 kDa N-terminal domain of enzyme I of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system by multidimensional NMR." Biochemistry 36:2517-2530. Pubmed: 9054557
  • Garrett, D. S., Seok, Y. J., Peterkofsky, A., Clore, G. M., Gronenborn, A. M. (1998). "Tautomeric state and pKa of the phosphorylated active site histidine in the N-terminal domain of enzyme I of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system." Protein Sci 7:789-793. Pubmed: 9541412
  • Garrett, D. S., Seok, Y. J., Peterkofsky, A., Gronenborn, A. M., Clore, G. M. (1999). "Solution structure of the 40,000 Mr phosphoryl transfer complex between the N-terminal domain of enzyme I and HPr." Nat Struct Biol 6:166-173. Pubmed: 10048929
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Liao, D. I., Silverton, E., Seok, Y. J., Lee, B. R., Peterkofsky, A., Davies, D. R. (1996). "The first step in sugar transport: crystal structure of the amino terminal domain of enzyme I of the E. coli PEP: sugar phosphotransferase system and a model of the phosphotransfer complex with HPr." Structure 4:861-872. Pubmed: 8805571
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Powell, B. S., Court, D. L., Inada, T., Nakamura, Y., Michotey, V., Cui, X., Reizer, A., Saier, M. H. Jr, Reizer, J. (1995). "Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant." J Biol Chem 270:4822-4839. Pubmed: 7876255
  • Saffen, D. W., Presper, K. A., Doering, T. L., Roseman, S. (1987). "Sugar transport by the bacterial phosphotransferase system. Molecular cloning and structural analysis of the Escherichia coli ptsH, ptsI, and crr genes." J Biol Chem 262:16241-16253. Pubmed: 2960675
  • Teplyakov, A., Lim, K., Zhu, P. P., Kapadia, G., Chen, C. C., Schwartz, J., Howard, A., Reddy, P. T., Peterkofsky, A., Herzberg, O. (2006). "Structure of phosphorylated enzyme I, the phosphoenolpyruvate:sugar phosphotransferase system sugar translocation signal protein." Proc Natl Acad Sci U S A 103:16218-16223. Pubmed: 17053069
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837