Identification
Name:2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase
Synonyms:Not Available
Gene Name:cpdB
Enzyme Class:
Biological Properties
General Function:Involved in hydrolase activity
Specific Function:This bifunctional enzyme catalyzes two consecutive reactions during ribonucleic acid degradation. Converts a 2',3'- cyclic nucleotide to a 3'-nucleotide and then the 3'-nucleotide to the corresponding nucleoside and phosphate
Cellular Location:Periplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb
Thumb+ThumbThumb
Thumb+ThumbThumb
Thumb+ThumbNucleoside 3'-phosphate
2',3'-Cyclic nucleotide + Water ↔ Nucleoside 3'-phosphate
ReactionCard
3'-Ribonucleotide+ThumbThumb+Thumb
3'-Ribonucleotide + WaterRibonucleoside + Phosphate
ReactionCard
SMPDB Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
a nucleoside 3'-phosphate+Thumba ribonucleoside+Thumb
a nucleoside 3'-phosphate + Water → a ribonucleoside + Phosphate
ReactionCard
a nucleoside 2',3'-cyclic phosphate+Thumba nucleoside 3'-phosphate+Thumb
a nucleoside 2',3'-cyclic phosphate + Water → a nucleoside 3'-phosphate + Hydrogen ion
ReactionCard
Complex Reactions:
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb+Thumb
Nucleoside 2',3'-cyclic phosphate+Thumbnucleoside 3'-phosphate
Nucleoside 2',3'-cyclic phosphate + Water → nucleoside 3'-phosphate
ReactionCard
A 3'-ribonucleotide+Thumba ribonucleoside+Thumb
A 3'-ribonucleotide + Water → a ribonucleoside + Inorganic phosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB211342',3'-Cyclic CMPMetaboCard
ECMDB200622',3'-Cyclic UMPMetaboCard
ECMDB035403'-AMPMetaboCard
ECMDB200793'-CMPMetaboCard
ECMDB200813'-UMPMetaboCard
ECMDB00050AdenosineMetaboCard
ECMDB11616Adenosine 2',3'-cyclic phosphateMetaboCard
ECMDB00089CytidineMetaboCard
ECMDB00133GuanosineMetaboCard
ECMDB11629Guanosine 2',3'-cyclic phosphateMetaboCard
ECMDB20157Guanosine 3'-phosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21380Inorganic phosphateMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00296UridineMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
binding
catalytic activity
cation binding
cyclic-nucleotide phosphodiesterase activity
hydrolase activity
hydrolase activity, acting on ester bonds
ion binding
metal ion binding
nucleotide binding
phosphoric diester hydrolase activity
phosphoric ester hydrolase activity
Process
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide catabolic process
nucleotide metabolic process
Gene Properties
Blattner:b4213
Gene OrientationCounterclockwise
Centisome Percentage:95.54
Left Sequence End4432645
Right Sequence End4434588
Gene Sequence:
>1944 bp
ATGATTAAGTTTAGCGCAACGCTCCTGGCCACGCTGATTGCCGCCAGTGTGAATGCAGCG
ACGGTCGATCTGCGTATCATGGAAACCACTGATCTGCATAGCAACATGATGGATTTCGAT
TATTACAAAGACACCGCCACGGAAAAATTCGGACTGGTACGTACGGCAAGCCTGATTAAC
GATGCCCGCAATGAAGTGAAAAACAGCGTACTGGTTGATAACGGCGATTTGATTCAGGGG
AGTCCGCTGGCCGATTACATGTCGGCGAAAGGATTAAAAGCAGGTGATATTCACCCGGTC
TATAAGGCATTAAATACGCTGGACTATACCGTCGGAACGCTTGGCAACCACGAGTTTAAC
TACGGTCTGGATTACCTGAAAAATGCGCTGGCAGGAGCGAAATTCCCTTATGTAAATGCC
AACGTCATTGACGCCAGAACCAAACAGCCAATGTTTACACCGTATTTAATTAAAGACACC
GAAGTGGTCGATAAAGACGGAAAAAAACAGACGCTGAAGATTGGCTATATTGGCGTCGTG
CCACCACAAATCATGGGCTGGGATAAAGCTAATTTATCCGGGAAAGTGACGGTGAATGAT
ATTACCGAAACCGTGCGCAAATACGTGCCTGAAATGCGCGAGAAAGGTGCCGATGTTGTT
GTCGTTCTGGCACATTCCGGGCTATCTGCCGATCCGTATAAAGTGATGGCGGAAAACTCA
GTTTATTACCTCAGTGAAATTCCGGGCGTTAACGCCATTATGTTTGGCCATGCTCACGCC
GTTTTCCCAGGTAAAGATTTTGCTGATATCGAAGGGGCTGATATCGCCAAAGGCACGCTG
AATGGTGTTCCGGCGGTAATGCCAGGCATGTGGGGCGATCATCTTGGTGTGGTCGACTTA
CAACTCAGTAATGACAGCGGTAAATGGCAGGTGACGCAGGCGAAAGCGGAAGCACGACCG
ATTTACGACATCGCTAATAAAAAATCCCTCGCGGCGGAAGACAGCAAGCTGGTAGAAACA
CTCAAAGCCGATCACGATGCCACACGCCAGTTCGTCAGCAAGCCAATCGGTAAATCTGCC
GACAATATGTATAGCTATCTGGCGCTGGTGCAGGACGATCCGACCGTGCAGGTGGTGAAC
AACGCGCAAAAAGCGTATGTCGAGCATTACATTCAGGGCGATCCGGATCTGGCAAAACTG
CCGGTGCTTTCAGCTGCCGCACCGTTTAAAGTCGGTGGTCGCAAAAATGACCCGGCAAGC
TATGTGGAGGTGGAAAAAGGCCAGTTGACCTTCCGTAATGCCGCCGATCTTTATCTCTAT
CCCAATACGCTGATTGTGGTGAAAGCCAGCGGTAAAGAGGTGAAAGAGTGGCTGGAGTGC
TCCGCGGGACAGTTTAACCAGATTGATCCCAACAGCACGAAACCACAGTCACTCATCAAC
TGGGATGGTTTCCGCACTTATAACTTTGATGTTATTGATGGTGTGAATTATCAGATTGAT
GTTACCCAGCCCGCCCGTTATGACGGCGAGTGCCAGATGATTAATGCCAATGCGGAAAGG
ATTAAGAACCTGACCTTTAATGGCAAGCCGATTGATCCGAACGCCATGTTCCTGGTTGCC
ACCAATAACTATCGCGCTTACGGCGGCAAATTTGCCGGTACGGGCGACAGCCATATCGCT
TTTGCTTCACCGGATGAGAACCGCTCGGTGCTGGCAGCGTGGATTGCTGATGAGTCGAAA
CGTGCGGGGGAAATTCACCCGGCGGCAGATAACAACTGGCGTTTAGCACCGATAGCTGGC
GATAAGAAACTGGATATCCGTTTCGAAACCTCTCCGTCAGATAAAGCCGCAGCGTTTATT
AAAGAGAAAGGGCAGTATCCGATGAATAAAGTCGCGACCGATGATATCGGGTTTGCGATT
TATCAGGTGGATTTGAGTAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:647
Protein Molecular Weight:70832
Protein Theoretical pI:5
Signaling Regions:
  • 1-19
Transmembrane Regions:
  • None
Protein Sequence:
>2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase
MIKFSATLLATLIAASVNAATVDLRIMETTDLHSNMMDFDYYKDTATEKFGLVRTASLIN
DARNEVKNSVLVDNGDLIQGSPLADYMSAKGLKAGDIHPVYKALNTLDYTVGTLGNHEFN
YGLDYLKNALAGAKFPYVNANVIDARTKQPMFTPYLIKDTEVVDKDGKKQTLKIGYIGVV
PPQIMGWDKANLSGKVTVNDITETVRKYVPEMREKGADVVVVLAHSGLSADPYKVMAENS
VYYLSEIPGVNAIMFGHAHAVFPGKDFADIEGADIAKGTLNGVPAVMPGMWGDHLGVVDL
QLSNDSGKWQVTQAKAEARPIYDIANKKSLAAEDSKLVETLKADHDATRQFVSKPIGKSA
DNMYSYLALVQDDPTVQVVNNAQKAYVEHYIQGDPDLAKLPVLSAAAPFKVGGRKNDPAS
YVEVEKGQLTFRNAADLYLYPNTLIVVKASGKEVKEWLECSAGQFNQIDPNSTKPQSLIN
WDGFRTYNFDVIDGVNYQIDVTQPARYDGECQMINANAERIKNLTFNGKPIDPNAMFLVA
TNNYRAYGGKFAGTGDSHIAFASPDENRSVLAAWIADESKRAGEIHPAADNNWRLAPIAG
DKKLDIRFETSPSDKAAAFIKEKGQYPMNKVATDDIGFAIYQVDLSK
References
External Links:
ResourceLink
Uniprot ID:P08331
Uniprot Name:CPDB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676964
Ecogene ID:EG10160
Ecocyc:EG10160
ColiBase:b4213
Kegg Gene:b4213
EchoBASE ID:EB0158
CCDB:CPDB_ECOLI
BacMap:16132035
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Liu, J., Beacham, I. R. (1990). "Transcription and regulation of the cpdB gene in Escherichia coli K12 and Salmonella typhimurium LT2: evidence for modulation of constitutive promoters by cyclic AMP-CRP complex." Mol Gen Genet 222:161-165. Pubmed: 2172762
  • Liu, J., Burns, D. M., Beacham, I. R. (1986). "Isolation and sequence analysis of the gene (cpdB) encoding periplasmic 2',3'-cyclic phosphodiesterase." J Bacteriol 165:1002-1010. Pubmed: 3005231