Canmetcon
Identification
Name:Nitrite reductase [NAD(P)H] large subunit
Synonyms:Not Available
Gene Name:nirB
Enzyme Class:
Biological Properties
General Function:Involved in oxidation-reduction process
Specific Function:Ammonium hydroxide + 3 NAD(P)(+) + H(2)O = nitrite + 3 NAD(P)H
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+3 Thumb+2 ThumbThumb+Thumb+3 Thumb+5 Thumb
SMPDB Reactions:
Nitrite+3 Thumb+5 Thumb+Thumb ? Thumb+2 Thumb+3 Thumb
Complex Reactions:
5 Thumb+3 Thumb+Thumb2 Thumb+3 Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
ECMDB02786NitriteMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
adenyl nucleotide binding
binding
catalytic activity
cation binding
FAD or FADH2 binding
heme binding
ion binding
iron ion binding
iron-sulfur cluster binding
metal cluster binding
metal ion binding
NADP or NADPH binding
nitrite reductase [NAD(P)H] activity
nucleoside binding
nucleotide binding
oxidoreductase activity
oxidoreductase activity, acting on other nitrogenous compounds as donors
oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
purine nucleoside binding
transition metal ion binding
Process
metabolic process
nitrate assimilation
nitrate metabolic process
nitrogen compound metabolic process
oxidation reduction
Gene Properties
Blattner:b3365
Gene OrientationClockwise
Centisome Percentage:75.26
Left Sequence End3492033
Right Sequence End3494576
Gene Sequence:
>2544 bp
ATGAATAAGACAACTGAGTACATTGACGCAATGCCCATCGCCGCAAGCGAGAAAGCGGCA
TTGCCGAAGACTGATATCCGCGCCGTTCATCAGGCGCTGGATGCCGAACACCGCACCTGG
GCGCGGGAGGATGATTCCCCGCAAGGCTCGGTAAAGGCGCGTCTGGAACAAGCCTGGCCA
GATTCACTTGCTGATGGACAGTTAATTAAAGACGACGAAGGGCGCGATCAGCTGAAGGCG
ATGCCAGAAGCAAAACGCTCCTCGATGTTTCCCGACCCGTGGCGTACCAACCCGGTAGGC
CGTTTCTGGGATCGCCTGCGTGGACGCGATGTCACGCCGCGCTATCTGGCTCGTTTGACC
AAAGAAGAGCAGGAGAGCGAGCAAAAGTGGCGTACCGTCGGTACCATCCGCCGTTACATT
CTGTTGATCCTGACGCTCGCGCAAACTGTCGTCGCGACCTGGTATATGAAGACCATTCTT
CCTTATCAGGGTTGGGCGCTGATTAATCCTATGGATATGGTTGGTCAGGATTTGTGGGTT
TCCTTTATGCAGCTTCTGCCTTATATGCTGCAAACCGGTATCCTGATCCTCTTTGCGGTA
CTGTTCTGTTGGGTGTCCGCCGGATTCTGGACGGCGTTAATGGGCTTCCTGCAACTGCTT
ATTGGTCGCGATAAATACAGTATATCTGCGTCAACAGTTGGCGATGAACCATTAAACCCG
GAGCATCGCACGGCGTTGATCATGCCTATCTGTAACGAAGACGTGAACCGTGTTTTTGCT
GGCCTGCGTGCAACGTGGGAATCAGTAAAAGCCACCGGGAATGCCAAACACTTTGATGTC
TACATTCTTAGTGACAGTTATAACCCGGATATCTGCGTCGCAGAGCAAAAAGCCTGGATG
GAGCTTATCGCTGAAGTCGGTGGCGAAGGTCAGATTTTCTATCGCCGCCGCCGTCGCCGC
GTGAAGCGTAAAAGCGGTAATATCGATGACTTCTGCCGTCGCTGGGGCAGCCAGTACAGC
TACATGGTGGTGCTGGATGCTGACTCGGTAATGACCGGTGATTGTTTGTGCGGGCTGGTG
CGCCTGATGGAAGCCAACCCGAACGCCGGGATCATTCAGTCGTCGCCGAAAGCGTCCGGT
ATGGATACGCTGTATGCGCGCTGTCAGCAGTTCGCGACCCGCGTGTATGGGCCACTGTTT
ACAGCCGGTTTGCACTTCTGGCAACTTGGCGAGTCGCACTACTGGGGACATAACGCGATT
ATCCGCGTGAAACCGTTTATCGAGCACTGCGCACTGGCTCCGCTGCCGGGCGAAGGTTCC
TTTGCCGGTTCAATCCTGTCACATGACTTCGTGGAAGCGGCGTTGATGCGCCGTGCAGGT
TGGGGGGTCTGGATTGCTTACGATCTCCCGGGTTCTTATGAAGAATTGCCGCCTAACTTG
CTTGATGAGCTAAAACGTGACCGCCGATGGTGCCACGGTAACCTGATGAACTTCCGTCTG
TTCCTGGTGAAGGGTATGCACCCGGTTCACCGTGCGGTGTTCCTGACGGGCGTGATGTCT
TATCTCTCCGCTCCGCTGTGGTTTATGTTCCTCGCGCTCTCTACTGCATTGCAGGTAGTG
CATGCGTTGACCGAACCGCAATACTTCCTGCAACCACGGCAGTTGTTCCCAGTGTGGCCG
CAGTGGCGTCCTGAGCTGGCGATTGCACTTTTTGCTTCGACCATGGTGCTGTTGTTCCTG
CCGAAGTTATTGAGCATTTTGCTTATCTGGTGCAAAGGAACGAAAGAATACGGCGGCTTC
TGGCGCGTTACATTATCGTTGCTGCTGGAAGTGCTTTTTTCCGTGCTGCTGGCTCCGGTA
CGCATGCTGTTCCATACGGTCTTCGTTGTCAGCGCGTTCCTTGGCTGGGAAGTGGTGTGG
AATTCACCGCAGCGTGATGATGACTCCACTTCCTGGGGTGAAGCGTTCAAACGCCACGGC
TCACAGCTGCTGTTAGGGTTAGTGTGGGCTGTTGGGATGGCGTGGCTGGATCTGCGTTTC
CTGTTCTGGCTGGCACCGATTGTCTTCTCGTTGATCCTGTCACCGTTTGTTTCGGTGATT
TCCAGCCGTGCCACCGTTGGTCTGCGCACCAAACGCTGGAAACTGTTCCTGATCCCGGAA
GAGTATTCGCCGCCGCAGGTGCTGGTTGATACCGATCGGTTCCTTGAGATGAATCGTCAA
CGCTCCCTTGATGATGGCTTTATGCACGCAGTGTTTAACCCGTCATTTAACGCTCTGGCA
ACCGCAATGGCGACCGCGCGTCACCGCGCCAGTAAGGTGCTGGAAATCGCCCGTGACCGC
CACGTTGAACAGGCGCTGAACGAGACGCCAGAGAAGCTGAATCGCGATCGTCGCCTGGTG
CTGCTAAGCGATCCGGTGACGATGGCCCGTCTGCATTTCCGTGTCTGGAATTCCCCGGAG
AGATATTCTTCATGGGTGAGTTATTACGAAGGGATAAAGCTCAATCCACTGGCATTGCGT
AAACCGGATGCGGCTTCGCAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:847
Protein Molecular Weight:93121
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Nitrite reductase [NAD(P)H] large subunit
MSKVRLAIIGNGMVGHRFIEDLLDKSDAANFDITVFCEEPRIAYDRVHLSSYFSHHTAEE
LSLVREGFYEKHGIKVLVGERAITINRQEKVIHSSAGRTVFYDKLIMATGSYPWIPPIKG
SDTQDCFVYRTIEDLNAIESCARRSKRGAVVGGGLLGLEAAGALKNLGIETHVIEFAPML
MAEQLDQMGGEQLRRKIESMGVRVHTSKNTLEIVQEGVEARKTMRFADGSELEVDFIVFS
TGIRPRDKLATQCGLDVAPRGGIVINDSCQTSDPDIYAIGECASWNNRVFGLVAPGYKMA
QVAVDHILGSENAFEGADLSAKLKLLGVDVGGIGDAHGRTPGARSYVYLDESKEIYKRLI
VSEDNKTLLGAVLVGDTSDYGNLLQLVLNAIELPENPDSLILPAHSGSGKPSIGVDKLPD
SAQICSCFDVTKGDLIAAINKGCHTVAALKAETKAGTGCGGCIPLVTQVLNAELAKQGIE
VNNNLCEHFAYSRQELFHLIRVEGIKTFEELLAKHGKGYGCEVCKPTVGSLLASCWNEYI
LKPEHTPLQDSNDNFLANIQKDGTYSVIPRSPGGEITPEGLMAVGRIAREFNLYTKITGS
QRLAMFGAQKDDLPEIWRQLIEAGFETGHAYAKALRMAKTCVGSTWCRYGVGDSVGLGVE
LENRYKGIRTPHKMKFGVSGCTRECSEAQGKDVGIIATEKGWNLYVCGNGGMKPRHADLL
AADIDRETLIKYLDRFMMFYIRTADKLTRTAPWLENLEGGIDYLKAVIIDDKLGLNAHLE
EEMARLREAVLCEWTETVNTPSAQTRFKHFINSDKRDPNVQMVPEREQHRPATPYERIPV
TLVEDNA
References
External Links:
ResourceLink
Uniprot ID:P08201
Uniprot Name:NIRB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651516
Ecogene ID:EG10653
Ecocyc:EG10653
ColiBase:b3365
Kegg Gene:b3365
EchoBASE ID:EB0647
CCDB:NIRB_ECOLI
BacMap:16131244
General Reference:
  • Bell, A. I., Gaston, K. L., Cole, J. A., Busby, S. J. (1989). "Cloning of binding sequences for the Escherichia coli transcription activators, FNR and CRP: location of bases involved in discrimination between FNR and CRP." Nucleic Acids Res 17:3865-3874. Pubmed: 2543955
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jayaraman, P. S., Peakman, T. C., Busby, S. J., Quincey, R. V., Cole, J. A. (1987). "Location and sequence of the promoter of the gene for the NADH-dependent nitrite reductase of Escherichia coli and its regulation by oxygen, the Fnr protein and nitrite." J Mol Biol 196:781-788. Pubmed: 2445993
  • Peakman, T., Crouzet, J., Mayaux, J. F., Busby, S., Mohan, S., Harborne, N., Wootton, J., Nicolson, R., Cole, J. (1990). "Nucleotide sequence, organisation and structural analysis of the products of genes in the nirB-cysG region of the Escherichia coli K-12 chromosome." Eur J Biochem 191:315-323. Pubmed: 2200672