Identification
Name:Acetolactate synthase isozyme 1 large subunit
Synonyms:
  • AHAS-I
  • Acetohydroxy-acid synthase I large subunit
  • ALS-I
Gene Name:ilvB
Enzyme Class:
Biological Properties
General Function:Involved in magnesium ion binding
Specific Function:2 pyruvate = 2-acetolactate + CO(2)
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+2 ThumbThumb+Thumb
Thumb+Thumb2 Thumb
Thumb+Thumb2 Thumb
2 ThumbThumb+Thumb
SMPDB Reactions:
2 Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB06855(S)-2-AcetolactateMetaboCard
ECMDB040012-Aceto-2-hydroxy-butyrateMetaboCard
ECMDB040022-AcetolactateMetaboCard
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB01372Thiamine pyrophosphateMetaboCard
GO Classification:
Function
acetolactate synthase activity
adenyl nucleotide binding
binding
catalytic activity
cation binding
FAD or FADH2 binding
ion binding
magnesium ion binding
metal ion binding
nucleoside binding
purine nucleoside binding
thiamin pyrophosphate binding
transferase activity
transferase activity, transferring aldehyde or ketonic groups
vitamin binding
Process
branched chain family amino acid biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid biosynthetic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b3671
Gene OrientationCounterclockwise
Centisome Percentage:82.96
Left Sequence End3849119
Right Sequence End3850807
Gene Sequence:
>1689 bp
ATGGCAAGTTCGGGCACAACATCGACGCGTAAGCGCTTTACCGGCGCAGAATTTATCGTT
CATTTCCTGGAACAGCAGGGCATTAAGATTGTGACAGGCATTCCGGGCGGTTCTATCCTG
CCTGTTTACGATGCCTTAAGCCAAAGCACGCAAATCCGCCATATTCTGGCCCGTCATGAA
CAGGGCGCGGGCTTTATCGCTCAGGGAATGGCGCGCACCGACGGTAAACCGGCGGTCTGT
ATGGCCTGTAGCGGACCGGGTGCGACTAACCTGGTGACCGCCATTGCCGATGCGCGGCTG
GACTCCATCCCGCTGATTTGCATCACTGGTCAGGTTCCCGCCTCGATGATCGGCACCGAC
GCCTTCCAGGAAGTGGACACCTACGGCATCTCTATCCCCATCACCAAACACAACTATCTG
GTCAGACATATCGAAGAACTCCCGCAGGTCATGAGCGATGCCTTCCGCATTGCGCAATCA
GGCCGCCCAGGCCCGGTGTGGATAGACATTCCTAAGGATGTGCAAACGGCAGTTTTTGAG
ATTGAAACACAGCCCGCTATGGCAGAAAAAGCCGCCGCCCCCGCCTTTAGCGAAGAAAGC
ATTCGTGACGCAGCGGCGATGATTAACGCTGCCAAACGCCCGGTGCTTTATCTGGGCGGC
GGTGTGATCAATGCGCCCGCACGGGTGCGTGAACTGGCGGAGAAAGCGCAACTGCCTACC
ACCATGACTTTAATGGCGCTGGGCATGTTGCCAAAAGCGCATCCGTTGTCGCTGGGTATG
CTGGGGATGCACGGCGTGCGCAGCACCAACTATATTTTGCAGGAGGCGGATTTGTTGATA
GTGCTCGGTGCGCGTTTTGATGACCGGGCGATTGGCAAAACCGAGCAGTTCTGTCCGAAT
GCCAAAATCATTCATGTCGATATCGACCGTGCAGAGCTGGGTAAAATCAAGCAGCCGCAC
GTGGCGATTCAGGCGGATGTTGATGACGTGCTGGCGCAGTTGATCCCGCTGGTGGAAGCG
CAACCGCGTGCAGAGTGGCACCAGTTGGTAGCGGATTTGCAGCGTGAGTTTCCGTGTCCA
ATCCCGAAAGCGTGCGATCCGTTAAGCCATTACGGCCTGATCAACGCCGTTGCCGCCTGT
GTCGATGACAATGCAATTATCACCACCGACGTTGGTCAGCATCAGATGTGGACCGCGCAA
GCTTATCCGCTCAATCGCCCACGCCAGTGGCTGACCTCCGGTGGGCTGGGCACGATGGGT
TTTGGCCTGCCTGCGGCGATTGGCGCTGCGCTGGCGAACCCGGATCGCAAAGTGTTGTGT
TTCTCCGGCGACGGCAGCCTGATGATGAATATTCAGGAGATGGCGACCGCCAGTGAAAAT
CAGCTGGATGTCAAAATCATTCTGATGAACAACGAAGCGCTGGGGCTGGTGCATCAGCAA
CAGAGTCTGTTCTACGAGCAAGGCGTTTTTGCCGCCACCTATCCGGGCAAAATCAACTTT
ATGCAGATTGCCGCCGGATTCGGCCTCGAAACCTGTGATTTGAATAACGAAGCCGATCCG
CAGGCTTCATTGCAGGAAATCATCAATCGCCCTGGCCCGGCGCTGATCCATGTGCGCATT
GATGCCGAAGAAAAAGTTTACCCGATGGTGCCGCCAGGTGCGGCGAATACTGAAATGGTG
GGGGAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:562
Protein Molecular Weight:60440
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetolactate synthase isozyme 1 large subunit
MASSGTTSTRKRFTGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHE
QGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTD
AFQEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIAQSGRPGPVWIDIPKDVQTAVFE
IETQPAMAEKAAAPAFSEESIRDAAAMINAAKRPVLYLGGGVINAPARVRELAEKAQLPT
TMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIVLGARFDDRAIGKTEQFCPN
AKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPLVEAQPRAEWHQLVADLQREFPCP
IPKACDPLSHYGLINAVAACVDDNAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTMG
FGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEALGLVHQQ
QSLFYEQGVFAATYPGKINFMQIAAGFGLETCDLNNEADPQASLQEIINRPGPALIHVRI
DAEEKVYPMVPPGAANTEMVGE
References
External Links:
ResourceLink
Uniprot ID:P08142
Uniprot Name:ILVB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676372
Ecogene ID:EG10494
Ecocyc:EG10494
ColiBase:b3671
Kegg Gene:b3671
EchoBASE ID:EB0489
CCDB:ILVB_ECOLI
BacMap:16131541
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Friden, P., Donegan, J., Mullen, J., Tsui, P., Freundlich, M., Eoyang, L., Weber, R., Silverman, P. M. (1985). "The ilvB locus of Escherichia coli K-12 is an operon encoding both subunits of acetohydroxyacid synthase I." Nucleic Acids Res 13:3979-3993. Pubmed: 2989781
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Wek, R. C., Hauser, C. A., Hatfield, G. W. (1985). "The nucleotide sequence of the ilvBN operon of Escherichia coli: sequence homologies of the acetohydroxy acid synthase isozymes." Nucleic Acids Res 13:3995-4010. Pubmed: 2989782