Identification
Name:Pyruvate dehydrogenase [cytochrome]
Synonyms:
  • Pyruvate dehydrogenase [Ubiquinone]
  • Pyruvate oxidase
  • POX
  • Alpha-peptide
Gene Name:poxB
Enzyme Class:
Biological Properties
General Function:Involved in magnesium ion binding
Specific Function:Pyruvate + ferricytochrome b1 + H(2)O = acetate + CO(2) + ferrocytochrome b1
Cellular Location:Cell membrane; Peripheral membrane protein
SMPDB Pathways:
  • pyruvate to cytochrome bd terminal oxidase electron transfer PW002087
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
2 Thumb+2 ThumbThumb+Thumb+Thumb+Electron
Complex Reactions:
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
ECMDB03243AcetoinMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB21574Ubiquinol-1MetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB20487Ubiquinone-0MetaboCard
ECMDB21438Ubiquinone-1MetaboCard
ECMDB01072Ubiquinone-10MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
binding
catalytic activity
cation binding
ion binding
magnesium ion binding
metal ion binding
thiamin pyrophosphate binding
transferase activity
vitamin binding
Gene Properties
Blattner:b0871
Gene OrientationCounterclockwise
Centisome Percentage:19.58
Left Sequence End908554
Right Sequence End910272
Gene Sequence:
>1719 bp
ATGAAACAAACGGTTGCAGCTTATATCGCCAAAACACTCGAATCGGCAGGGGTGAAACGC
ATCTGGGGAGTCACAGGCGACTCTCTGAACGGTCTTAGTGACAGTCTTAATCGCATGGGC
ACCATCGAGTGGATGTCCACCCGCCACGAAGAAGTGGCGGCCTTTGCCGCTGGCGCTGAA
GCACAACTTAGCGGAGAACTGGCGGTCTGCGCCGGATCGTGCGGCCCCGGCAACCTGCAC
TTAATCAACGGCCTGTTCGATTGCCACCGCAATCACGTTCCGGTACTGGCGATTGCCGCT
CATATTCCCTCCAGCGAAATTGGCAGCGGCTATTTCCAGGAAACCCACCCACAAGAGCTA
TTCCGCGAATGTAGTCACTATTGCGAGCTGGTTTCCAGCCCGGAGCAGATCCCACAAGTA
CTGGCGATTGCCATGCGCAAAGCGGTGCTTAACCGTGGCGTTTCGGTTGTCGTGTTACCA
GGCGACGTGGCGTTAAAACCTGCGCCAGAAGGGGCAACCATGCACTGGTATCATGCGCCA
CAACCAGTCGTGACGCCGGAAGAAGAAGAGTTACGCAAACTGGCGCAACTGCTGCGTTAT
TCCAGCAATATCGCCCTGATGTGTGGCAGCGGCTGCGCGGGGGCGCATAAAGAGTTAGTT
GAGTTTGCCGGGAAAATTAAAGCGCCTATTGTTCATGCCCTGCGCGGTAAAGAACATGTC
GAATACGATAATCCGTATGATGTTGGAATGACCGGGTTAATCGGCTTCTCGTCAGGTTTC
CATACCATGATGAACGCCGACACGTTAGTGCTACTCGGCACGCAATTTCCCTACCGCGCC
TTCTACCCGACCGATGCCAAAATCATTCAGATTGATATCAACCCAGCCAGCATCGGCGCT
CACAGCAAGGTGGATATGGCACTGGTCGGCGATATCAAGTCGACTCTGCGTGCATTGCTT
CCATTGGTGGAAGAAAAAGCCGATCGCAAGTTTCTGGATAAAGCGCTGGAAGATTACCGC
GACGCCCGCAAAGGGCTGGACGATTTAGCTAAACCGAGCGAGAAAGCCATTCACCCGCAA
TATCTGGCGCAGCAAATTAGTCATTTTGCCGCCGATGACGCTATTTTCACCTGTGACGTT
GGTACGCCAACGGTGTGGGCGGCACGTTATCTAAAAATGAACGGCAAGCGTCGCCTGTTA
GGTTCGTTTAACCACGGTTCGATGGCTAACGCCATGCCGCAGGCGCTGGGTGCGCAGGCG
ACAGAGCCAGAACGTCAGGTGGTCGCCATGTGCGGCGATGGCGGTTTTAGCATGTTGATG
GGCGATTTCCTCTCAGTAGTGCAGATGAAACTGCCAGTGAAAATTGTCGTCTTTAACAAC
AGCGTGCTGGGCTTTGTGGCGATGGAGATGAAAGCTGGTGGCTATTTGACTGACGGCACC
GAACTACACGACACAAACTTTGCCCGCATTGCCGAAGCGTGCGGCATTACGGGTATCCGT
GTAGAAAAAGCGTCTGAAGTTGATGAAGCCCTGCAACGCGCCTTCTCCATCGACGGTCCG
GTGTTGGTGGATGTGGTGGTCGCCAAAGAAGAGTTAGCCATTCCACCGCAGATCAAACTC
GAACAGGCCAAAGGTTTCAGCCTGTATATGCTGCGCGCAATCATCAGCGGACGCGGTGAT
GAAGTGATCGAACTGGCGAAAACAAACTGGCTAAGGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:572
Protein Molecular Weight:62011
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Pyruvate dehydrogenase [cytochrome]
MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHEEVAAFAAGAE
AQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQEL
FRECSHYCELVSSPEQIPQVLAIAMRKAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAP
QPVVTPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHV
EYDNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQIDINPASIGA
HSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYRDARKGLDDLAKPSEKAIHPQ
YLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAQA
TEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAGGYLTDGT
ELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAIPPQIKL
EQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
References
External Links:
ResourceLink
Uniprot ID:P07003
Uniprot Name:POXB_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651398
Ecogene ID:EG10754
Ecocyc:EG10754
ColiBase:b0871
Kegg Gene:b0871
EchoBASE ID:EB0747
CCDB:POXB_ECOLI
BacMap:16128839
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chang, Y. Y., Wang, A. Y., Cronan, J. E. Jr (1994). "Expression of Escherichia coli pyruvate oxidase (PoxB) depends on the sigma factor encoded by the rpoS(katF) gene." Mol Microbiol 11:1019-1028. Pubmed: 8022274
  • Grabau, C., Chang, Y. Y., Cronan, J. E. Jr (1989). "Lipid binding by Escherichia coli pyruvate oxidase is disrupted by small alterations of the carboxyl-terminal region." J Biol Chem 264:12510-12519. Pubmed: 2663858
  • Grabau, C., Cronan, J. E. Jr (1986). "Nucleotide sequence and deduced amino acid sequence of Escherichia coli pyruvate oxidase, a lipid-activated flavoprotein." Nucleic Acids Res 14:5449-5460. Pubmed: 3016647
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Recny, M. A., Grabau, C., Cronan, J. E. Jr, Hager, L. P. (1985). "Characterization of the alpha-peptide released upon protease activation of pyruvate oxidase." J Biol Chem 260:14287-14291. Pubmed: 3902830