Identification
Name:Histidine biosynthesis bifunctional protein hisIE
Synonyms:
  • Phosphoribosyl-AMP cyclohydrolase
  • PRA-CH
  • Phosphoribosyl-ATP pyrophosphatase
  • PRA-PH
Gene Name:hisI
Enzyme Class:
Biological Properties
General Function:Involved in phosphoribosyl-AMP cyclohydrolase activity
Specific Function:1-(5-phosphoribosyl)-ATP + H(2)O = 1-(5- phosphoribosyl)-AMP + diphosphate
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
SMPDB Reactions:
Phosphoribosyl-ATP+Thumb+ThumbThumb+Pyrophosphate+Thumb
Phosphoribosyl-ATP + Water + Phosphoribosyl-ATPHydrogen ion + Pyrophosphate + Phosphoribosyl-AMP
ReactionCard
Thumb+ThumbThumb
EcoCyc Reactions:
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
Thumb+ThumbThumb
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB231951-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamideMetaboCard
ECMDB01517AICARMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB04137Phosphoribosyl-AMPMetaboCard
ECMDB04138Phosphoribosyl-ATPMetaboCard
ECMDB12277PhosphoribosylformiminoAICAR-phosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
catalytic activity
cyclohydrolase activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
phosphoribosyl-AMP cyclohydrolase activity
phosphoribosyl-ATP diphosphatase activity
pyrophosphatase activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
histidine biosynthetic process
histidine family amino acid metabolic process
histidine metabolic process
metabolic process
Gene Properties
Blattner:b2026
Gene OrientationClockwise
Centisome Percentage:45.15
Left Sequence End2094638
Right Sequence End2095249
Gene Sequence:
>612 bp
GTGAAATTGAGATGGTTTGCCTTTTTGATTGTGTTATTAGCGGGTTGTTCATCAAAGCAT
GACTATACGAACCCGCCGTGGAACGCGAAAGTTCCGGTGCAACGTGCGATGCAGTGGATG
CCAATAAGCCAGAAAGCCGGTGCAGCCTGGGGCGTCGATCCACAATTGATCACGGCGATT
ATCGCTATCGAATCGGGTGGTAATCCGAACGCGGTGAGTAAATCGAATGCCATTGGTTTG
ATGCAGTTAAAAGCTTCAACCTCCGGACGTGATGTTTATCGCCGTATGGGCTGGAGTGGT
GAGCCGACGACCAGCGAGCTGAAAAATCCAGAGCGTAATATTTCAATGGGGGCGGCTTAC
CTGAATATTCTGGAAACCGGCCCGCTGGCAGGCATTGAAGATCCGAAGGTACTGCAATAT
GCGCTGGTGGTGTCATACGCTAACGGGGCAGGTGCGCTGCTACGGACTTTCTCGTCAGAT
CGGAAAAAGGCGATCAGCAAAATCAACGATTTGGATGCTGACGAGTTCCTCGAACACGTA
GCGCGAAATCACCCTGCGCCGCAGGCTCCGCGCTATATCTACAAACTTGAGCAGGCACTG
GACGCGATGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:203
Protein Molecular Weight:22756
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Histidine biosynthesis bifunctional protein hisIE
MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQR
LWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQ
LLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHL
LVLLQDQGLDLTTVIENLRKRHQ
References
External Links:
ResourceLink
Uniprot ID:P06989
Uniprot Name:HIS2_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674869
Ecogene ID:EG10451
Ecocyc:EG10451
ColiBase:b2026
Kegg Gene:b2026
EchoBASE ID:EB0446
CCDB:HIS2_ECOLI
BacMap:16129967
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Carlomagno, M. S., Chiariotti, L., Alifano, P., Nappo, A. G., Bruni, C. B. (1988). "Structure and function of the Salmonella typhimurium and Escherichia coli K-12 histidine operons." J Mol Biol 203:585-606. Pubmed: 3062174
  • Chiariotti, L., Alifano, P., Carlomagno, M. S., Bruni, C. B. (1986). "Nucleotide sequence of the Escherichia coli hisD gene and of the Escherichia coli and Salmonella typhimurium hisIE region." Mol Gen Genet 203:382-388. Pubmed: 3018428
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Jovanovic, G., Kostic, T., Jankovic, M., Savic, D. J. (1994). "Nucleotide sequence of the Escherichia coli K12 histidine operon revisited." J Mol Biol 239:433-435. Pubmed: 8201624
  • Kido, N., Torgov, V. I., Sugiyama, T., Uchiya, K., Sugihara, H., Komatsu, T., Kato, N., Jann, K. (1995). "Expression of the O9 polysaccharide of Escherichia coli: sequencing of the E. coli O9 rfb gene cluster, characterization of mannosyl transferases, and evidence for an ATP-binding cassette transport system." J Bacteriol 177:2178-2187. Pubmed: 7536735