Canmetcon
Identification
Name:Ketol-acid reductoisomerase
Synonyms:
  • Acetohydroxy-acid isomeroreductase
  • Alpha-keto-beta-hydroxylacil reductoisomerase
Gene Name:ilvC
Enzyme Class:
Biological Properties
General Function:Involved in oxidation-reduction process
Specific Function:(R)-2,3-dihydroxy-3-methylbutanoate + NADP(+) = (S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH
Cellular Location:Not Available
SMPDB Pathways:
  • Pantothenate and CoA biosynthesis PW000828
  • Secondary Metabolites: Valine and I-leucine biosynthesis from pyruvate PW000978
  • Valine Biosynthesis PW000812
  • isoleucine biosynthesis PW000818
KEGG Pathways:
KEGG Reactions:
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb+1.0Thumb
1.0Thumb1.0Thumb
1.0Thumb1.0Thumb
SMPDB Reactions:
1.0Thumb+1.0Thumb+1.0NADPH+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0NADPH+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.02-dehydropantoate+1.0NADPH+1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0(R)-pantoate+1.0Thumb
1.02-dehydropantoate + 1.0NADPH + 1.0Hydrogen ion + 1.02-Dehydropantoate + 1.0NADPH → 1.0NADP + 1.0(R)-pantoate + 1.0(R)-Pantoate
ReactionCard
1.0Thumb+1.0Thumb+1.0NADPH+1.0Thumb1.0Thumb+1.0Thumb
EcoCyc Reactions:
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
Complex Reactions:
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb1.0Thumb+1.0Thumb
Metabolites:
ECMDB IDNameView
ECMDB12140(R) 2,3-Dihydroxy-3-methylvalerateMetaboCard
ECMDB04059(R)-2,3-Dihydroxy-isovalerateMetaboCard
ECMDB20014(R)-3-Hydroxy-3-methyl-2-oxopentanoateMetaboCard
ECMDB20016(R)-PantoateMetaboCard
ECMDB06855(S)-2-AcetolactateMetaboCard
ECMDB214802,3-Dihydroxyisovaleric acidMetaboCard
ECMDB040012-Aceto-2-hydroxy-butyrateMetaboCard
ECMDB040022-AcetolactateMetaboCard
ECMDB040432-DehydropantoateMetaboCard
ECMDB200703-Hydroxy-3-methyl-2-oxobutanoic acidMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
GO Classification:
Function
binding
catalytic activity
ketol-acid reductoisomerase activity
NADP or NADPH binding
nucleotide binding
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Process
branched chain family amino acid biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid biosynthetic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
oxidation reduction
Gene Properties
Blattner:b3774
Gene OrientationClockwise
Centisome Percentage:85.26
Left Sequence End3955993
Right Sequence End3957468
Gene Sequence:
>1476 bp
ATGAATACACAACAATTGGCAAAACTGCGTTCCATCGTGCCCGAAATGCGTCGCGTTCGG
CACATACATTTTGTCGGCATTGGTGGTGCCGGTATGGGCGGTATTGCCGAAGTTCTGGCC
AATGAAGGTTATCAGATCAGTGGTTCCGATTTAGCGCCAAATCCGGTCACGCAGCAGTTA
ATGAATCTGGGTGCGACGATTTATTTCAACCATCGCCCGGAAAACGTACGTGATGCCAGC
GTGGTCGTTGTTTCCAGCGCGATTTCTGCCGATAACCCGGAAATTGTCGCCGCTCATGAA
GCGCGTATTCCGGTGATCCGTCGTGCCGAAATGCTGGCTGAGTTAATGCGTTTTCGTCAT
GGCATCGCCATTGCCGGAACGCACGGCAAAACGACAACCACCGCGATGGTTTCCAGCATC
TACGCAGAAGCGGGGCTCGACCCAACCTTCGTTAACGGCGGGCTGGTAAAAGCGGCGGGG
GTTCATGCGCGTTTGGGGCATGGTCGGTACCTGATTGCCGAAGCAGATGAGAGTGATGCA
TCGTTCCTGCATCTGCAACCGATGGTGGCGATTGTCACCAATATCGAAGCCGACCACATG
GATACCTACCAGGGCGACTTTGAGAATTTAAAACAGACTTTTATTAATTTTCTGCACAAC
CTGCCGTTTTACGGTCGTGCGGTGATGTGTGTTGATGATCCGGTGATCCGCGAATTGTTA
CCGCGAGTGGGGCGTCAGACCACGACTTACGGCTTCAGCGAAGATGCCGACGTGCGTGTA
GAAGATTATCAGCAGATTGGCCCGCAGGGGCACTTTACGCTGCTGCGCCAGGACAAAGAG
CCGATGCGCGTCACCCTGAATGCGCCAGGTCGTCATAACGCGCTGAACGCCGCAGCTGCG
GTTGCGGTTGCTACGGAAGAGGGCATTGACGACGAGGCTATTTTGCGGGCGCTTGAAAGC
TTCCAGGGGACTGGTCGCCGTTTTGATTTCCTCGGTGAATTCCCGCTGGAGCCAGTGAAT
GGTAAAAGCGGTACGGCAATGCTGGTCGATGACTACGGCCACCACCCGACGGAAGTGGAC
GCCACCATTAAAGCGGCGCGCGCAGGCTGGCCGGATAAAAACCTGGTAATGCTGTTTCAG
CCGCACCGTTTTACCCGTACGCGCGACCTGTATGATGATTTCGCCAATGTGCTGACGCAG
GTTGATACCCTGTTGATGCTGGAAGTGTATCCGGCTGGCGAAGCGCCAATTCCGGGAGCG
GACAGCCGTTCGCTGTGTCGCACAATTCGTGGACGTGGGAAAATTGATCCCATTCTGGTG
CCGGATCCGGCGCGGGTAGCCGAGATGCTGGCACCGGTATTAACCGGTAACGACCTGATT
CTCGTTCAGGGGGCTGGTAATATTGGAAAAATTGCCCGTTCTTTAGCTGAAATCAAACTG
AAGCCGCAAACTCCGGAGGAAGAACAACATGACTGA
Protein Properties
Pfam Domain Function:
Protein Residues:491
Protein Molecular Weight:54069
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Ketol-acid reductoisomerase
MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDSG
LDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDKQHSDVVRTVQP
LMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEGKIGEQEYFDKGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNGQLRDVNEAIRSHAIEQVGKKLRGY
MTDMKRIAVAG
References
External Links:
ResourceLink
Uniprot ID:P05793
Uniprot Name:ILVC_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21321972
Ecogene ID:EG10495
Ecocyc:EG10495
ColiBase:b3774
Kegg Gene:b3774
EchoBASE ID:EB0490
CCDB:ILVC_ECOLI
BacMap:16131632
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Wek, R. C., Hatfield, G. W. (1986). "Nucleotide sequence and in vivo expression of the ilvY and ilvC genes in Escherichia coli K12. Transcription from divergent overlapping promoters." J Biol Chem 261:2441-2450. Pubmed: 3003115