Canmetcon
Identification
Name:Lipoprotein 28
Synonyms:Not Available
Gene Name:nlpA
Enzyme Class:Not Available
Biological Properties
General Function:plasma membrane
Specific Function:Not Available
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
Metabolites:
ECMDB IDNameView
GO Classification:
Function
plasma membrane
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>819
atgaaactgacaacacatcatctacggacaggggccgcattattgctggccggaattctg
ctggcaggttgcgaccagagtagcagcgatgcaaaacacattaaagttggcgttataaat
ggcgcagaacaagatgtcgcggaagtcgctaaaaaggtggcaaaagagaaatatggcctc
gatgttgaactggtaggatttagcggttcgttgctaccgaacgatgcgacaaatcatggc
gaacttgatgcgaatgtcttccagcatcgaccctttcttgaacaagataatcaggcgcat
ggttataaactggtagcggtgggaaatacgtttgtcttccctatggcgggttattccaaa
aaaatcaaaaccgtggcgcaaataaaagaaggcgcgacagtggcgatccccaacgacccg
accaaccttggtcgcgcacttttactgttgcaaaaagagaagctaattactctgaaagag
ggaaaagggttattacctaccgcgctggatataaccgataatcctcgtcatttgcagatt
atggaactcgagggggcgcagctcccgcgcgtactggatgatcccaaagttgatgtagcg
attatcagcaccacttacattcagcagaccgggctttctccggtgcacgacagcgtattt
attgaagataagaattcgccgtatgtgaatattttggtggcacgggaagataataagaat
gcagaaaacgtgaaggaatttctgcaatcttatcaatcacccgaagtcgctaaagcggca
gaaaccatttttaacggtggcgcggtgcctggctggtaa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:272
Protein Molecular Weight:29423
Protein Theoretical pI:Not Available
Signaling Regions:
  • 1-23
Transmembrane Regions:Not Available
Protein Sequence:
>Lipoprotein 28
MKLTTHHLRTGAALLLAGILLAGCDQSSSDAKHIKVGVINGAEQDVAEVAKKVAKEKYGL
DVELVGFSGSLLPNDATNHGELDANVFQHRPFLEQDNQAHGYKLVAVGNTFVFPMAGYSK
KIKTVAQIKEGATVAIPNDPTNLGRALLLLQKEKLITLKEGKGLLPTALDITDNPRHLQI
MELEGAQLPRVLDDPKVDVAIISTTYIQQTGLSPVHDSVFIEDKNSPYVNILVAREDNKN
AENVKEFLQSYQSPEVAKAAETIFNGGAVPGW
References
External Links:
ResourceLink
Uniprot ID:P04846
Uniprot Name:NLPA_ECOLI
CCDB:NLPA_ECOLI
General Reference:Not Available