Identification
Name:Adenylate cyclase
Synonyms:
  • ATP pyrophosphate-lyase
  • Adenylyl cyclase
Gene Name:cyaA
Enzyme Class:
Biological Properties
General Function:Involved in adenylate cyclase activity
Specific Function:ATP = 3',5'-cyclic AMP + diphosphate
Cellular Location:Cytoplasm
SMPDB Pathways:Not Available
KEGG Pathways:
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
ThumbThumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB00058Cyclic AMPMetaboCard
ECMDB04034Cyclic GMPMetaboCard
ECMDB01273Guanosine triphosphateMetaboCard
ECMDB04142PyrophosphateMetaboCard
GO Classification:
Function
adenylate cyclase activity
catalytic activity
cyclase activity
Process
cAMP biosynthetic process
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
Gene Properties
Blattner:b3806
Gene OrientationClockwise
Centisome Percentage:85.98
Left Sequence End3989176
Right Sequence End3991722
Gene Sequence:
>2547 bp
ATGAACAATAACGATCTCTTTCAGGCATCACGTCGGCGTTTTCTGGCACAACTCGGCGGC
TTAACCGTCGCCGGGATGCTGGGGCCGTCATTGTTAACGCCGCGACGTGCGACTGCGGCG
CAAGCGGCGACTGACGCTGTCATCTCGAAAGAGGGCATTCTTACCGGGTCGCACTGGGGG
GCTATCCGCGCGACGGTGAAGGATGGTCGCTTTGTGGCGGCAAAACCGTTCGAACTGGAT
AAATATCCGTCGAAAATGATTGCCGGATTGCCGGATCACGTACACAACGCGGCGCGTATT
CGTTATCCGATGGTACGCGTGGACTGGCTGCGTAAGCGCCATCTCAGCGATACCTCCCAG
CGCGGTGATAACCGTTTTGTGCGCGTGAGCTGGGATGAAGCCCTCGACATGTTCTATGAA
GAACTGGAACGCGTGCAGAAAACTCACGGGCCGAGTGCCTTGCTGACCGCCAGTGGTTGG
CAATCGACGGGGATGTTCCATAACGCTTCGGGGATGCTGGCGAAAGCTATTGCCTTGCAT
GGTAATAGCGTTGGTACGGGCGGAGATTACTCTACCGGTGCTGCGCAGGTGATCCTGCCG
CGCGTAGTCGGTTCGATGGAAGTGTATGAACAGCAAACCTCCTGGCCGCTGGTATTGCAG
AACAGCAAAACCATTGTGCTGTGGGGCTCCGATTTGCTGAAAAACCAGCAAGCGAACTGG
TGGTGCCCGGATCACGATGTTTATGAATATTACGCGCAGCTAAAAGCGAAAGTCGCCGCC
GGTGAAATTGAGGTCATCAGCATCGATCCGGTTGTCACATCCACCCATGAGTATCTGGGG
CGCGAGCATGTGAAGCACATTGCGGTTAACCCGCAAACTGACGTGCCGCTGCAACTGGCG
CTGGCACATACGCTGTACAGTGAAAACCTGTACGACAAAAACTTCCTTGCTAACTACTGT
GTGGGTTTTGAGCAGTTCCTGCCGTATCTGCTGGGTGAGAAAGACGGTCAGCCGAAAGAT
GCCGCATGGGCTGAAAAACTGACCGGCATTGATGCCGAAACCATTCGTGGGCTGGCGCGG
CAGATGGCGGCGAACAGAACGCAAATTATTGCTGGCTGGTGCGTGCAGCGTATGCAGCAC
GGTGAACAGTGGGCGTGGATGATTGTGGTTCTGGCGGCGATGCTGGGGCAAATTGGCCTG
CCAGGTGGTGGTTTTGGTTTTGGCTGGCACTACAACGGCGCAGGCACGCCGGGGCGTAAA
GGCGTTATTCTGAGTGGTTTCTCCGGCTCTACGTCGATTCCGCCTGTTCACGACAACAGT
GACTACAAAGGCTACAGCAGCACTATTCCGATTGCCCGTTTTATCGATGCGATCCTCGAA
CCGGGGAAAGTGATCAACTGGAACGGTAAATCGGTAAAACTGCCGCCGCTGAAAATGTGT
ATTTTTGCCGGAACTAACCCATTCCATCGCCATCAGCAGATCAACCGCATTATTGAAGGC
TTGCGCAAGCTGGAAACGGTTATCGCCATAGATAACCAGTGGACCTCAACCTGCCGCTTT
GCCGATATCGTACTGCCTGCGACCACGCAGTTTGAGCGTAACGATCTCGACCAGTACGGC
AATCACTCCAACCGTGGCATTATCGCCATGAAACAGGTGGTGCCGCCGCAGTTCGAGGCG
CGCAACGACTTCGATATTTTCCGCGAGCTGTGCCGTCGCTTTAATCGCGAAGAAGCCTTT
ACCGAAGGGCTGGACGAAATGGGCTGGCTGAAACGCATCTGGCAGGAAGGTGTACAGCAA
GGCAAAGGACGCGGCGTTCATCTGCCAGCGTTTGATGACTTCTGGAATAACAAAGAGTAC
GTCGAGTTTGACCATCCGCAGATGTTTGTTCGCCACCAGGCATTCCGCGAAGATCCGGAT
CTCGAACCGCTGGGCACGCCGAGTGGCCTGATTGAGATCTACTCGAAAACTATCGCCGAT
ATGAACTACGACGATTGTCAGGGGCATCCGATGTGGTTTGAGAAAATCGAACGCTCCCAC
GGTGGGCCTGGCTCGCAAAAGTATCCGTTGCATCTGCAATCTGTGCATCCGGATTTCCGA
CTTCACTCGCAGTTATGTGAGTCGGAAACGCTGCGTCAGCAATATACGGTAGCGGGTAAA
GAGCCAGTATTCATTAACCCGCAGGATGCCAGCGCGCGCGGTATTCGTAACGGTGATGTG
GTACGCGTCTTTAACGCTCGCGGTCAGGTGTTGGCAGGGGCAGTGGTTTCTGACCGCTAT
GCACCCGGCGTGGCACGAATTCACGAAGGGGCATGGTACGATCCAGATAAAGGCGGCGAG
CCTGGTGCGCTGTGCAAATACGGTAACCCCAACGTGTTGACCATCGACATCGGTACATCG
CAGCTGGCGCAGGCGACCAGTGCGCACACTACGCTGGTGGAAATTGAGAAGTACAACGGA
ACAGTGGAGCAGGTGACGGCGTTTAACGGCCCCGTGGAGATGGTGGCGCAGTGCGAATAT
GTTCCCGCGTCGCAGGTGAAATCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:848
Protein Molecular Weight:97585
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Adenylate cyclase
MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG
ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVC
HQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI
LLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSA
EEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLD
PYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGW
DEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR
KLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQ
PLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTP
KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRN
SWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSE
CIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSV
QVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELV
RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDT
PLLQQYFS
References
External Links:
ResourceLink
Uniprot ID:P00936
Uniprot Name:CYAA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:1651489
Ecogene ID:EG10170
Ecocyc:EG10170
ColiBase:b3806
Kegg Gene:b3806
EchoBASE ID:EB0168
CCDB:CYAA_ECOLI
BacMap:16131658
General Reference:
  • Aiba, H. (1985). "Transcription of the Escherichia coli adenylate cyclase gene is negatively regulated by cAMP-cAMP receptor protein." J Biol Chem 260:3063-3070. Pubmed: 2982847
  • Aiba, H., Kawamukai, M., Ishihama, A. (1983). "Cloning and promoter analysis of the Escherichia coli adenylate cyclase gene." Nucleic Acids Res 11:3451-3465. Pubmed: 6344011
  • Aiba, H., Mori, K., Tanaka, M., Ooi, T., Roy, A., Danchin, A. (1984). "The complete nucleotide sequence of the adenylate cyclase gene of Escherichia coli." Nucleic Acids Res 12:9427-9440. Pubmed: 6393056
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Danchin, A. (1993). "Phylogeny of adenylyl cyclases." Adv Second Messenger Phosphoprotein Res 27:109-162. Pubmed: 8418825
  • Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Roy, A., Haziza, C., Danchin, A. (1983). "Regulation of adenylate cyclase synthesis in Escherichia coli: nucleotide sequence of the control region." EMBO J 2:791-797. Pubmed: 6357786
  • Trotot, P., Sismeiro, O., Vivares, C., Glaser, P., Bresson-Roy, A., Danchin, A. (1996). "Comparative analysis of the cya locus in enterobacteria and related gram-negative facultative anaerobes." Biochimie 78:277-287. Pubmed: 8874804