Canmetcon
Identification
Name:D-serine dehydratase
Synonyms:
  • D-serine deaminase
  • DSD
Gene Name:dsdA
Enzyme Class:
Biological Properties
General Function:Involved in D-serine ammonia-lyase activity
Specific Function:D-serine = pyruvate + NH(3)
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:
  • Glycine, serine and threonine metabolism ec00260
KEGG Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb+Thumb
Thumb+Thumb+Thumb+ThumbThumb+Thumb
SMPDB Reactions:
ThumbThumb+Thumb+Thumb
EcoCyc Reactions:
ThumbThumb+Thumb+Thumb
Complex Reactions:
ThumbThumb+Thumb
ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB036092-Aminoacrylic acidMetaboCard
ECMDB00051AmmoniaMetaboCard
ECMDB21186AmmoniumMetaboCard
ECMDB03406D-SerineMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
ammonia-lyase activity
binding
carbon-nitrogen lyase activity
catalytic activity
cofactor binding
D-serine ammonia-lyase activity
lyase activity
pyridoxal phosphate binding
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular metabolic process
D-amino acid metabolic process
metabolic process
Gene Properties
Blattner:b2366
Gene OrientationClockwise
Centisome Percentage:53.39
Left Sequence End2477224
Right Sequence End2478552
Gene Sequence:
>1329 bp
ATGTCCAGAATCAATAAGTTCGTACTTACAGTCAGTCTGCTGATTTTTATCATGATTTCA
GCAGTTGCCTGCGGGATCTACACTCAAATGGTAAAGGAACGGGTGTATAGCCTGAAACAG
TCCGTTATTGATACTGCTTTTGCGGTGGCAAATATTGCTGAATATCGGCGTAGCGTGGCA
ATTGATCTTATCAACACGCTAAATCCCACGGAGGAACAGCTGTTGGTTGGTTTGCGCACA
GCTTACGCCGACTCGGTTTCCCCCTCTTATTTGTACGATGTCGGTCCTTATCTGATTTCC
AGTGACGAATGTATTCAGGTAAAGGAGTTCGAGAAAAATTATTGTGCAGATATTATGCAG
GTTGTGAAGTATCGACATGTCAAAAATACAGGGTTTATCTCTTTTGACGGTAAAACCTTC
GTCTATTACCTCTATCCGGTAACTCACAATCGTAGTCTGATATTTTTGCTTGGTCTGGAG
CGTTTTTCTTTACTGTCAAAATCGCTGGCGATGGACAGCGAGAACCTGATGTTCTCTCTA
TTTAAGAACGGTAAACCGGTGACCGGTGATGAATATAATGCTAAAAACGCCATCTTCACC
GTTTCGGAAGCGATGGAGCACTTCGCCTATTTGCCGACCGGATTGTATGTATTTGCGTAT
AAAAAAGATGTTTATTTGCGGGTTTGTACATTGATTATTTTCTTTGCCGCATTGGTGGCA
GTGATATCGGGTGCCAGTTGCCTCTATCTGGTACGCAGAGTGATTAATCGTGGTATTGTG
GAGAAAGAAGCCATCATTAATAACCATTTTGAACGCGTACTGGATGGCGGGCTTTTCTTT
TCGGCTGCCGATGTCAAAAAACTCTACAGTATGTATAACTCGGCGTTCCTGGACGACCTG
ACCAAAGCAATGGGCAGAAAATCCTTTGACGAAGATTTAAAAGCGCTGCCGGAAAAAGGC
GGTTATTTGTGCCTGTTTGACGTCGATAAATTCAAAAACATTAACGACACCTTCGGTCAT
TTGCTGGGCGATGAAGTGTTGATGAAAGTGGTGAAAATCCTTAAATCACAGATCCCGGTA
GATAAAGGTAAAGTCTACCGCTTCGGCGGTGACGAATTTGCGGTGATTTATACGGGTGGA
ACGCTGGAAGAGTTGCTATCGATTCTAAAAGAAATCGTTCATTTCCAGGTGGGAAGCATT
AATTTAAGTACCAGTATCGGTGTAGCACATTCAAATGAATGTCCTACCGTCGAACGCTTG
AAAATGCTGGCGGATGAGCGGCTGTATAAGAGTAAGAAAAACGGCAGGGCACAGATTAGC
TGGCAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:442
Protein Molecular Weight:47900
Protein Theoretical pI:6
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>D-serine dehydratase
MENAKMNSLIAQYPLVKDLVALKETTWFNPGTTSLAEGLPYVGLTEQDVQDAHARLSRFA
PYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISGSIKAR
GGIYEVLAHAEKLALEAGLLTLDDDYSKLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSA
RIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPNCFFIDDEN
SRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLKLAFGDHVH
CFFAEPTHSPCMLLGVHTGLHDQISVQDIGIDNLTAADGLAVGRASGFVGRAMERLLDGF
YTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVCASVSYQQMHGFSAEQLRNTTHL
VWATGGGMVPEEEMNQYLAKGR
References
External Links:
ResourceLink
Uniprot ID:P00926
Uniprot Name:SDHD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062411
Ecogene ID:EG10249
Ecocyc:EG10249
ColiBase:b2366
Kegg Gene:b2366
EchoBASE ID:EB0245
CCDB:SDHD_ECOLI
BacMap:16130298
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Marceau, M., McFall, E., Lewis, S. D., Shafer, J. A. (1988). "D-serine dehydratase from Escherichia coli. DNA sequence and identification of catalytically inactive glycine to aspartic acid variants." J Biol Chem 263:16926-16933. Pubmed: 3053699
  • McFall, E., Runkel, L. (1983). "DNA sequences of the D-serine deaminase control region and N-terminal portion of the structural gene." J Bacteriol 154:1508-1512. Pubmed: 6343359
  • Schiltz, E., Schmitt, W. (1981). "Sequence of Escherichia coli D-serine dehydratase. Location of the pyridoxal-phosphate binding site." FEBS Lett 134:57-62. Pubmed: 9222324
  • Schiltz, E., Schnackerz, K. D. (1976). "Sequence studies on D-serine dehydratase of Escherichia coli. Primary structure of the tryptic phosphopyridoxyl peptide and of the N-terminus." Eur J Biochem 71:109-116. Pubmed: 795658
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837