Identification
Name:Acetolactate synthase isozyme 3 small subunit
Synonyms:
  • ALS-III
  • Acetohydroxy-acid synthase III small subunit
  • AHAS-III
Gene Name:ilvH
Enzyme Class:
Biological Properties
General Function:Involved in acetolactate synthase activity
Specific Function:2 pyruvate = 2-acetolactate + CO(2)
Cellular Location:Not Available
SMPDB Pathways:
  • 2-Oxopent-4-enoate metabolism PW001890
  • 2-Oxopent-4-enoate metabolism 2 PW002035
  • Operon: acetolactate synthase III activation PW001881
  • Pantothenate and CoA biosynthesis PW000828
  • Secondary Metabolites: Valine and I-leucine biosynthesis from pyruvate PW000978
  • Valine Biosynthesis PW000812
  • isoleucine biosynthesis PW000818
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Thumb+2 ThumbThumb+Thumb
Thumb+Thumb2 Thumb
Thumb+Thumb2 Thumb
2 ThumbThumb+Thumb
SMPDB Reactions:
2 Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+Thumb+ThumbThumb+Thumb
Complex Reactions:
2 ThumbThumb+Thumb
2 ThumbThumb+Thumb
2 ThumbThumb+Thumb
2 ThumbThumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB06855(S)-2-AcetolactateMetaboCard
ECMDB040012-Aceto-2-hydroxy-butyrateMetaboCard
ECMDB040022-AcetolactateMetaboCard
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB01372Thiamine pyrophosphateMetaboCard
GO Classification:
Function
acetolactate synthase activity
amino acid binding
binding
carboxylic acid binding
catalytic activity
transferase activity
transferase activity, transferring aldehyde or ketonic groups
Process
branched chain family amino acid biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid biosynthetic process
cellular amino acid metabolic process
cellular metabolic process
metabolic process
Gene Properties
Blattner:b0078
Gene OrientationClockwise
Centisome Percentage:1.88
Left Sequence End87357
Right Sequence End87848
Gene Sequence:
>492 bp
ATGCGCCGGATATTATCAGTCTTACTCGAAAATGAATCAGGCGCGTTATCCCGCGTGATT
GGCCTTTTTTCCCAGCGTGGCTACAACATTGAAAGCCTGACCGTTGCGCCAACCGACGAT
CCGACATTATCGCGTATGACCATCCAGACCGTGGGCGATGAAAAAGTACTTGAGCAGATC
GAAAAGCAATTACACAAACTGGTCGATGTCTTGCGCGTGAGTGAGTTGGGGCAGGGCGCG
CATGTTGAGCGGGAAATCATGCTGGTGAAAATTCAGGCCAGCGGTTACGGGCGTGACGAA
GTGAAACGTAATACGGAAATATTCCGTGGGCAAATTATCGATGTCACACCCTCGCTTTAT
ACCGTTCAATTAGCAGGCACCAGCGGTAAGCTTGATGCATTTTTAGCATCGATTCGCGAT
GTGGCGAAAATTGTGGAGGTTGCTCGCTCTGGTGTGGTCGGACTTTCGCGCGGCGATAAA
ATAATGCGTTGA
Protein Properties
Pfam Domain Function:
Protein Residues:163
Protein Molecular Weight:17977
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Acetolactate synthase isozyme 3 small subunit
MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI
EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY
TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
References
External Links:
ResourceLink
Uniprot ID:P00894
Uniprot Name:ILVH_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674320
Ecogene ID:EG10499
Ecocyc:EG10499
ColiBase:b0078
Kegg Gene:b0078
EchoBASE ID:EB0494
CCDB:ILVH_ECOLI
BacMap:16128071
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jahreis, K., Postma, P. W., Lengeler, J. W. (1991). "Nucleotide sequence of the ilvH-fruR gene region of Escherichia coli K12 and Salmonella typhimurium LT2." Mol Gen Genet 226:332-336. Pubmed: 1851954
  • Leclerc, G., Noel, G., Drapeau, G. R. (1990). "Molecular cloning, nucleotide sequence, and expression of shl, a new gene in the 2-minute region of the genetic map of Escherichia coli." J Bacteriol 172:4696-4700. Pubmed: 2198273
  • Squires, C. H., De Felice, M., Devereux, J., Calvo, J. M. (1983). "Molecular structure of ilvIH and its evolutionary relationship to ilvG in Escherichia coli K12." Nucleic Acids Res 11:5299-5313. Pubmed: 6308579
  • Yura, T., Mori, H., Nagai, H., Nagata, T., Ishihama, A., Fujita, N., Isono, K., Mizobuchi, K., Nakata, A. (1992). "Systematic sequencing of the Escherichia coli genome: analysis of the 0-2.4 min region." Nucleic Acids Res 20:3305-3308. Pubmed: 1630901