Identification
Name:NADH dehydrogenase
Synonyms:Not Available
Gene Name:ndh
Enzyme Class:
Biological Properties
General Function:Involved in oxidation-reduction process
Specific Function:Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Does not couple the redox reaction to proton translocation
Cellular Location:Cell membrane
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+Thumb+AcceptorThumb+Reduced acceptor
NADH + Hydrogen ion + Acceptor ↔ NAD + Reduced acceptor
ReactionCard
SMPDB Reactions:
Thumb+ThumbThumb+Thumb
EcoCyc Reactions:
Thumb+a ubiquinone+Thumba ubiquinol+Thumb
Hydrogen ion + a ubiquinone + NADH ↔ a ubiquinol + NAD
ReactionCard
Thumb+Thumb ? Thumb+Thumb+Cu+
Thumb+a ubiquinone+Thumba ubiquinol+Thumb
Hydrogen ion + a ubiquinone + NADH → a ubiquinol + NAD
ReactionCard
Complex Reactions:
Thumb+4 Thumb+ThumbThumb+Thumb+3 Thumb
4 Thumb+Thumb+ThumbThumb+Thumb+3 Thumb
4 Thumb+Menaquinone 8+ThumbThumb+Thumb+3 Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Thumb+ThumbThumb+Thumb
Thumb+Menaquinone 8+ThumbThumb+Thumb
Thumb+acceptorThumb+reduced acceptor
NADH + acceptor → NAD + reduced acceptor
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB211542-Demethylmenaquinol 8MetaboCard
ECMDB211552-Demethylmenaquinone 8MetaboCard
ECMDB00657CopperMetaboCard
ECMDB23003Cu(+)MetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB21245Menaquinol 8MetaboCard
ECMDB00902NADMetaboCard
ECMDB01487NADHMetaboCard
ECMDB01060Ubiquinol-8MetaboCard
ECMDB21296Ubiquinone-8MetaboCard
GO Classification:
Function
adenyl nucleotide binding
binding
catalytic activity
FAD or FADH2 binding
nucleoside binding
oxidoreductase activity
purine nucleoside binding
Process
metabolic process
oxidation reduction
Gene Properties
Blattner:b1109
Gene OrientationClockwise
Centisome Percentage:25.12
Left Sequence End1165308
Right Sequence End1166612
Gene Sequence:
>1305 bp
ATGAAATTTCCCGGTAAACGTAAATCCAAACATTACTTCCCCGTAAACGCACGCGATCCG
CTGCTTCAGCAATTCCAGCCAGAAAACGAAACCAGCGCTGCCTGGGTAGTGGGTATCGAT
CAAACGCTGGTCGATATTGAAGCGAAAGTGGATGATGAATTTATTGAGCGTTATGGATTA
AGCGCCGGGCATTCACTGGTGATTGAGGATGATGTAGCCGAAGCGCTTTATCAGGAACTA
AAACAGAAAAACCTGATTACCCATCAGTTTGCGGGTGGCACCATTGGTAACACCATGCAC
AACTACTCGGTGCTCGCGGACGACCGTTCGGTGCTGCTGGGCGTCATGTGCAGCAATATT
GAAATTGGCAGTTATGCCTATCGTTACCTGTGTAACACTTCCAGCCGTACCGATCTTAAC
TATCTACAAGGCGTGGATGGCCCGATTGGTCGTTGCTTTACGCTGATTGGCGAGTCCGGG
GAACGTACCTTTGCTATCAGTCCAGGCCACATGAACCAGCTGCGGGCTGAAAGCATTCCG
GAAGATGTGATTGCCGGAGCCTCGGCACTGGTTCTCACCTCATATCTGGTGCGTTGCAAG
CCGGGTGAACCCATGCCGGAAGCAACCATGAAAGCCATTGAGTACGCGAAGAAATATAAC
GTACCGGTGGTGCTGACGCTGGGCACCAAGTTTGTCATTGCCGAGAATCCGCAGTGGTGG
CAGCAATTCCTCAAAGATCACGTCTCTATCCTTGCGATGAACGAAGATGAAGCCGAAGCG
TTGACCGGAGAAAGCGATCCGTTGTTGGCATCTGACAAGGCGCTGGACTGGGTAGATCTG
GTGCTGTGCACCGCCGGGCCAATCGGCTTGTATATGGCGGGCTTTACCGAAGACGAAGCG
AAACGTAAAACCCAGCATCCGCTGCTGCCGGGCGCTATAGCGGAATTCAACCAGTATGAG
TTTAGCCGCGCCATGCGCCACAAGGATTGCCAGAATCCGCTGCGTGTATATTCGCACATT
GCGCCGTACATGGGCGGGCCGGAAAAAATCATGAACACTAATGGAGCGGGGGATGGCGCA
TTGGCAGCGTTGCTGCATGACATTACCGCCAACAGCTACCATCGTAGCAACGTACCAAAC
TCCAGCAAACATAAATTCACCTGGTTAACTTATTCATCGTTAGCGCAGGTGTGTAAATAT
GCTAACCGTGTGAGCTATCAGGTACTGAACCAGCATTCACCTCGTTTAACGCGCGGCTTG
CCGGAGCGTGAAGACAGCCTGGAAGAGTCTTACTGGGATCGTTAA
Protein Properties
Pfam Domain Function:
Protein Residues:434
Protein Molecular Weight:47358
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>NADH dehydrogenase
MTTPLKKIVIVGGGAGGLEMATQLGHKLGRKKKAKITLVDRNHSHLWKPLLHEVATGSLD
EGVDALSYLAHARNHGFQFQLGSVIDIDREAKTITIAELRDEKGELLVPERKIAYDTLVM
ALGSTSNDFNTPGVKENCIFLDNPHQARRFHQEMLNLFLKYSANLGANGKVNIAIVGGGA
TGVELSAELHNAVKQLHSYGYKGLTNEALNVTLVEAGERILPALPPRISAAAHNELTKLG
VRVLTQTMVTSADEGGLHTKDGEYIEADLMVWAAGIKAPDFLKDIGGLETNRINQLVVEP
TLQTTRDPDIYAIGDCASCPRPEGGFVPPRAQAAHQMATCAMNNILAQMNGKPLKNYQYK
DHGSLVSLSNFSTVGSLMGNLTRGSMMIEGRIARFVYISLYRMHQIALHGYFKTGLMMLV
GSINRVIRPRLKLH
References
External Links:
ResourceLink
Uniprot ID:P00393
Uniprot Name:DHNA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674616
Ecogene ID:EG10649
Ecocyc:EG10649
ColiBase:b1109
Kegg Gene:b1109
EchoBASE ID:EB0643
CCDB:DHNA_ECOLI
BacMap:16129072
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Young, I. G., Rogers, B. L., Campbell, H. D., Jaworowski, A., Shaw, D. C. (1981). "Nucleotide sequence coding for the respiratory NADH dehydrogenase of Escherichia coli. UUG initiation codon." Eur J Biochem 116:165-170. Pubmed: 6265208