Identification
Name:6-phosphogluconate dehydrogenase, decarboxylating
Synonyms:Not Available
Gene Name:gnd
Enzyme Class:
Biological Properties
General Function:Involved in oxidation-reduction process
Specific Function:Catalyzes the oxidative decarboxylation of 6- phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
KEGG Reactions:
Thumb+ThumbThumb+Thumb+Thumb+Thumb
Thumb+ThumbD-Ribulose 5-phosphate+Thumb+Thumb+Thumb
SMPDB Reactions:
Thumb+ThumbThumb+Thumb+NADPH+Thumb
gluconate 6-phosphate+ThumbNADPH+Thumb+Thumb+Thumb
gluconate 6-phosphate + NADP → NADPH + Carbon dioxide + D-Ribulose 5-phosphate + NADPH
ReactionCard
Complex Reactions:
Thumb+ThumbThumb+Thumb+Thumb
Metabolites:
ECMDB IDNameView
ECMDB013166-Phosphogluconic acidMetaboCard
ECMDB04030Carbon dioxideMetaboCard
ECMDB04148D-Ribulose 5-phosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00217NADPMetaboCard
ECMDB04111NADPHMetaboCard
GO Classification:
Function
binding
catalytic activity
coenzyme binding
cofactor binding
NADP or NADPH binding
nucleotide binding
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
phosphogluconate dehydrogenase (decarboxylating) activity
Process
alcohol metabolic process
glucose catabolic process
glucose metabolic process
hexose metabolic process
metabolic process
monosaccharide metabolic process
oxidation reduction
pentose-phosphate shunt
small molecule metabolic process
Gene Properties
Blattner:b2029
Gene OrientationCounterclockwise
Centisome Percentage:45.22
Left Sequence End2097886
Right Sequence End2099292
Gene Sequence:
>1407 bp
ATGCGTACGTTTAGTGGCAAACGTAGTACGCTGGCGCTGGCTATCGCCGGTGTTACAGCA
ATGTCGGGCTTTATGGCAATGCCGGAGGCTCGCGCCGAAGGATTCATCGACGATTCAACC
TTAACCGGCGGTATCTATTACTGGCAGCGTGAACGCGACCGTAAAGATGTTACCGACGGC
GACAAATACAAAACCAACCTTTCTCACTCCACCTGGAATGCCAACCTCGATTTTCAGTCC
GGTTATGCTGCTGATATGTTCGGCCTTGATATTGCTGCGTTTACGGCGATTGAAATGGCG
GAAAACGGCGACAGCTCCCACCCGAACGAAATCGCGTTTTCAAAAAGTAATAAAGCCTAT
GACGAAGACTGGTCCGGCGACAAAAGCGGTATAAGCCTGTATAAAGCTGCGGCCAAATTT
AAATACGGTCCGGTTTGGGCGAGGGCAGGTTACATTCAGCCAACTGGTCAAACGCTGTTA
GCGCCGCACTGGAGCTTTATGCCAGGTACTTATCAGGGGGCGGAAGCCGGGGCGAATTTT
GATTACGGCGATGCTGGTGCGTTGAGTTTCTCCTACATGTGGACCAACGAATACAAAGCG
CCGTGGCATCTGGAAATGGATGAGTTTTATCAGAACGATAAAACCACCAAAGTTGATTAT
CTGCACTCCTTTGGGGCGAAATACGACTTCAAAAATAACTTCGTACTGGAAGCGGCATTT
GGTCAGGCGGAAGGGTATATCGATCAATATTTTGCCAAAGCCAGCTACAAATTTGATATC
GCCGGTAGCCCGTTAACCACCAGCTACCAGTTCTACGGTACCCGAGATAAAGTTGACGAT
CGCAGCGTCAACGACCTTTATGACGGCACCGCCTGGCTGCAAGCGTTGACCTTTGGTTAC
CGGGCGGCTGACGTAGTGGATTTGCGCCTCGAAGGCACCTGGGTTAAGGCTGACGGTCAG
CAGGGATACTTCCTGCAACGTATGACTCCAACCTACGCTTCCTCAAACGGTCGCCTGGAT
ATCTGGTGGGATAACCGTTCTGACTTCAACGCCAACGGCGAAAAAGCGGTCTTCTTCGGT
GCGATGTATGACCTGAAAAACTGGAATCTTCCAGGCTTCGCCATCGGCGCTTCCTACGTT
TACGCATGGGATGCTAAACCTGCGACCTGGCAGAGCAATCCGGATGCGTACTACGACAAA
AACCGGACTATTGAAGAGTCTGCCTACAGCCTGGATGCGGTCTATACCATTCAGGACGGT
CGCGCCAAAGGCACGATGTTCAAACTGCATTTCACCGAATACGACAACCACTCCGACATC
CCAAGCTGGGGCGGTGGTTACGGCAACATCTTCCAGGATGAGCGTGACGTGAAATTTATG
GTAATCGCACCATTCACCATCTTCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:468
Protein Molecular Weight:51481
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>6-phosphogluconate dehydrogenase, decarboxylating
MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
References
External Links:
ResourceLink
Uniprot ID:P00350
Uniprot Name:6PGD_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674737
Ecogene ID:EG10411
Ecocyc:EG10411
ColiBase:b2029
Kegg Gene:b2029
EchoBASE ID:EB0406
CCDB:6PGD_ECOLI
BacMap:16129970
General Reference:
  • Barcak, G. J., Wolf, R. E. Jr (1988). "Comparative nucleotide sequence analysis of growth-rate-regulated gnd alleles from natural isolates of Escherichia coli and from Salmonella typhimurium LT-2." J Bacteriol 170:372-379. Pubmed: 3275621
  • Bisercic, M., Feutrier, J. Y., Reeves, P. R. (1991). "Nucleotide sequences of the gnd genes from nine natural isolates of Escherichia coli: evidence of intragenic recombination as a contributing factor in the evolution of the polymorphic gnd locus." J Bacteriol 173:3894-3900. Pubmed: 2050640
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chen, Y. Y., Ko, T. P., Chen, W. H., Lo, L. P., Lin, C. H., Wang, A. H. (2010). "Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism." J Struct Biol 169:25-35. Pubmed: 19686854
  • Dykhuizen, D. E., Green, L. (1991). "Recombination in Escherichia coli and the definition of biological species." J Bacteriol 173:7257-7268. Pubmed: 1938920
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Itoh, T., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Kasai, H., Kimura, S., Kitakawa, M., Kitagawa, M., Makino, K., Miki, T., Mizobuchi, K., Mori, H., Mori, T., Motomura, K., Nakade, S., Nakamura, Y., Nashimoto, H., Nishio, Y., Oshima, T., Saito, N., Sampei, G., Seki, Y., Horiuchi, T., et, a. l. .. (1996). "A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map." DNA Res 3:379-392. Pubmed: 9097040
  • Marolda, C. L., Valvano, M. A. (1993). "Identification, expression, and DNA sequence of the GDP-mannose biosynthesis genes encoded by the O7 rfb gene cluster of strain VW187 (Escherichia coli O7:K1)." J Bacteriol 175:148-158. Pubmed: 7677991
  • Miller, R. D., Dykhuizen, D. E., Hartl, D. L. (1988). "Fitness effects of a deletion mutation increasing transcription of the 6-phosphogluconate dehydrogenase gene in Escherichia coli." Mol Biol Evol 5:691-703. Pubmed: 2464736
  • Nasoff, M. S., Baker, H. V. 2nd, Wolf, R. E. Jr (1984). "DNA sequence of the Escherichia coli gene, gnd, for 6-phosphogluconate dehydrogenase." Gene 27:253-264. Pubmed: 6329905