Canmetcon
Identification
Name:Histidine kinase
Synonyms:Not Available
Gene Name:pmrB
Enzyme Class:
Biological Properties
General Function:phosphorelay sensor kinase activity
Specific Function:Not Available
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Function
ATP binding
integral component of membrane
intracellular
phosphorelay sensor kinase activity
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1092
atgcattttctgcgccgaccaatatcgctgcgccaacggctgatattgaccatcggggcc
attttgttggtgtttgagctgatcagcgtcttctggctatggcatgaaagtaccgagcag
attcagctgtttgagcaggcgctacgcgacaatcgcaacaacgatcgccacatcatgcgt
gagatccgcgaggcggtcgccagcctgattgtccccggcgtctttatggtcagcctgacg
ctatttatctgctatcaggcggtacgccgcatcacccgcccgctggcggagctgcaaaaa
gagctggaagcgcgcaccgccgacaacttaacgcccattgccattcacagcgccaccctc
gaaatcgaagcggtggtttcggcgttaaacgatctggtcagtcgcctgaccagcacgctg
gataacgaaaggttgtttaccgctgacgtcgcgcacgaactgcgaacgccactggcgggg
gtgcgtttgcatctggaactgctggcgaaaacgcatcacattgatgtagcaccgttagtg
gcacggcttgatcagatgatggagagcgtctcccagctgctgcaactggcgcgtgccgga
cagtcattttcttccggtaattatcaacatgtaaaactgctggaagatgtcattctcccc
tcgtatgacgaactcagtaccatgctcgaccagcgacagcaaaccctgctattgccagag
agcgccgccgacatcaccgttcagggtgatgcaaccctgctgcggatgttattgcgaaac
ctggtagaaaacgcccatcgttacagcccgcaaggcagcaacattatgattaagctgcaa
gaagatgacggagcggtcatggcagttgaagatgaaggaccaggtattgatgagagtaaa
tgcggggagttgagtaaagcgtttgtacgtatggacagccgttatggcgggattggtctg
gggttaagtattgtcagccgcattacacagttgcatcacgggcagtttttcctgcaaaac
cggcaagagacttccggcacgcgggcctgggtacggctgaagaaagatcagtacgtggca
aaccagatataa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:363
Protein Molecular Weight:41028
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Histidine kinase
MHFLRRPISLRQRLILTIGAILLVFELISVFWLWHESTEQIQLFEQALRDNRNNDRHIMR
EIREAVASLIVPGVFMVSLTLFICYQAVRRITRPLAELQKELEARTADNLTPIAIHSATL
EIEAVVSALNDLVSRLTSTLDNERLFTADVAHELRTPLAGVRLHLELLAKTHHIDVAPLV
ARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSYDELSTMLDQRQQTLLLPE
SAADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQEDDGAVMAVEDEGPGIDESK
CGELSKAFVRMDSRYGGIGLGLSIVSRITQLHHGQFFLQNRQETSGTRAWVRLKKDQYVA
NQI
References
External Links:
ResourceLink
Uniprot ID:G1E6H3
Uniprot Name:G1E6H3_ECOLI
CCDB:G1E6H3_ECOLI
General Reference:Not Available