Canmetcon
Identification
Name:Beta-galactosidase
Synonyms:Not Available
Gene Name:lacZ
Enzyme Class:
Biological Properties
General Function:carbohydrate metabolic process
Specific Function:Not Available
Cellular Location:Not Available
SMPDB Pathways:
KEGG Pathways:
Metabolites:
ECMDB IDNameView
ECMDB03345alpha-D-GlucoseMetaboCard
ECMDB00186alpha-LactoseMetaboCard
ECMDB00516b-D-GlucoseMetaboCard
ECMDB00143D-GalactoseMetaboCard
ECMDB00122D-GlucoseMetaboCard
ECMDB21653GalactanMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Function
beta-galactosidase activity
beta-galactosidase complex
carbohydrate binding
carbohydrate metabolic process
magnesium ion binding
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>3075
atgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgc
tttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcct
gaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatc
tacaccaacgtgacctatcccattacggtcaatccgccgtttgttcccacggagaatccg
acgggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggcgttaactcggcgtttcatctgtggtgcaacgggcgctgggtc
ggttacggccaggacagtcgtttgccgtctgaatttgacctgagcgcatttttacgcgcc
ggagaaaaccgcctcgcggtgatggtgctgcgctggagtgacggcagttatctggaagat
caggatatgtggcggatgagcggcattttccgtgacgtctcgttgctgcataaaccgact
acacaaatcagcgatttccatgttgccactcgctttaatgatgatttcagccgcgctgta
ctggaggctgaagttcagatgtgcggcgagttgcgtgactacctacgggtaacagtttct
ttatggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatc
gatgagcgtggtggttatgccgatcgcgtcacactacgtctgaacgtcgaaaacccgaaa
ctgtggagcgccgaaatcccgaatctctatcgtgcggtggttgaactgcacaccgccgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgaggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatg
aagcagaacaactttaacgccgtgcgctgttcgcattatccgaaccatccgctgtggtac
acgctgtgcgaccgctacggcctgtatgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggctaccggcgatgagcgaacgc
gtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgaatcaggccacggcgctaatcacgacgcgctgtatcgctggatcaaatctgtcgat
ccttcccgcccggtgcagtatgaaggcggcggagccgacaccacggccaccgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctacctggagagacgcgcccgctgatcctttgcgaatacgcc
cacgcgatgggtaacagtcttggcggtttcgctaaatactggcaggcgtttcgtcagtat
ccccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgat
gaaaacggcaacccgtggtcggcttacggcggtgattttggcgatacgccgaacgatcgc
cagttctgtatgaacggtctggtctttgccgaccgcacgccgcatccagcgctgacggaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcaaaccatcgaagtgacc
agcgaatacctgttccgtcatagcgataacgagctcctgcactggatggtggcgctggat
ggtaagccgctggcaagcggtgaagtgcctctggatgtcgctccacaaggtaaacagttg
attgaactgcctgaactaccgcagccggagagcgccgggcaactctggctcacagtacgc
gtagtgcaaccgaacgcgaccgcatggtcagaagccgggcacatcagcgcctggcagcag
tggcgtctggcggaaaacctcagtgtgacgctccccgccgcgtcccacgccatcccgcat
ctgaccaccagcgaaatggatttttgcatcgagctgggtaataagcgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgataaaaaacaactgctgacgccg
ctgcgcgatcagttcacccgtgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgaccctaacgcctgggtcgaacgctggaaggcggcgggccattaccaggccgaa
gcagcgttgttgcagtgcacggcagatacacttgctgatgcggtgctgattacgaccgct
cacgcgtggcagcatcaggggaaaaccttatttatcagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtggcgagcgatacaccgcatccg
gcgcggattggcctgaactgccagctggcgcaggtagcagagcgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgccgcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaacatc
agccgctacagtcaacagcaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggcacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtatcggcggaattccagctgagcgccggtcgctaccattaccagttggtc
tggtgtcaaaaataa
Protein Properties
Pfam Domain Function:Not Available
Protein Residues:1024
Protein Molecular Weight:116482
Protein Theoretical pI:Not Available
Signaling Regions:Not Available
Transmembrane Regions:Not Available
Protein Sequence:
>Beta-galactosidase
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV
LEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPK
LWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALD
GKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
References
External Links:
ResourceLink
Uniprot ID:G0ZKW2
Uniprot Name:G0ZKW2_ECOLI
CCDB:G0ZKW2_ECOLI
General Reference:Not Available