Canmetcon
Identification
Name:Vitamin B12 import system permease protein BtuC
Synonyms:Not Available
Gene Name:btuC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in cobalamin transport
Specific Function:Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Involved in the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB21386CyanocobalaminMetaboCard
GO Classification:
Component
cell part
membrane
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>981 bp
ATGCTGACACTTGCCCGCCAACAACAGCGACAAAATATTCGCTGGTTATTATGCCTGTCA
GTTTTGATGCTGCTGGCGCTTCTCTTAAGCCTTTGCGCCGGTGAACAATGGATCTCGCCA
GGTGACTGGTTTACTCCTCGTGGCGAACTGTTCGTCTGGCAAATTCGCCTGCCACGTACG
CTGGCTGTATTGCTGGTTGGTGCGGCGCTGGCTATATCCGGCGCTGTAATGCAGGCGTTG
TTTGAAAATCCTCTGGCAGAACCTGGACTACTTGGCGTCTCTAACGGCGCAGGCGTGGGG
CTTATCGCCGCGGTATTGCTTGGGCAAGGGCAACTCCCCAACTGGGCGCTAGGGCTGTGT
GCGATTGCTGGCGCGCTTATCATCACTTTAATACTCTTACGTTTCGCCCGTCGTCATCTT
TCGACCAGTCGGTTATTGCTGGCTGGCGTTGCATTAGGGATTATCTGTAGCGCACTAATG
ACGTGGGCTATCTACTTTTCCACCTCAGTTGATTTGCGTCAGCTGATGTACTGGATGATG
GGCGGTTTTGGCGGCGTAGACTGGCGGCAAAGCTGGCTGATGCTGGCATTGATCCCCGTG
TTGTTGTGGATCTGTTGTCAGTCCAGGCCGATGAATATGTTAGCACTTGGCGAGATCTCG
GCGCGGCAACTGGGTTTACCCCTGTGGTTCTGGCGCAATGTGCTGGTGGCAGCGACCGGC
TGGATGGTTGGCGTCAGTGTGGCGCTGGCGGGTGCTATCGGCTTTATTGGTCTGGTGATC
CCCCATATTCTCCGGTTGTGTGGTTTAACCGATCATCGCGTATTACTTCCCGGCTGCGCG
CTGGCAGGGGCGAGCGCATTGCTGCTGGCCGATATTGTAGCGCGCCTGGCATTAGCTGCC
GCAGAGCTGCCTATTGGCGTGGTCACCGCAACGTTAGGTGCGCCGGTGTTTATCTGGTTA
TTGTTAAAAGCAGGACGTTAG
Protein Properties
Pfam Domain Function:
Protein Residues:326
Protein Molecular Weight:34949
Protein Theoretical pI:10
PDB File:1L7V
Signaling Regions:
  • None
Transmembrane Regions:
  • 15-35
  • 61-81
  • 88-108
  • 112-132
  • 146-166
  • 184-204
  • 240-260
  • 274-294
  • 302-322
Protein Sequence:
>Vitamin B12 import system permease protein BtuC
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR
References
External Links:
ResourceLink
Uniprot ID:C4ZYH3
Uniprot Name:BTUC_ECOBW
GenBank Gene ID:CP001396
Genebank Protein ID:238863781
PDB ID:1L7V
CCDB:BTUC_ECOBW
General Reference:
  • Ferenci, T., Zhou, Z., Betteridge, T., Ren, Y., Liu, Y., Feng, L., Reeves, P. R., Wang, L. (2009). "Genomic sequencing reveals regulatory mutations and recombinational events in the widely used MC4100 lineage of Escherichia coli K-12." J Bacteriol 191:4025-4029. Pubmed: 19376874