Canmetcon
Identification
Name:Putative sialic acid transporter
Synonyms:
  • Sialic acid permease
Gene Name:nanT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transmembrane transport
Specific Function:May be a sugar-cation symporter involved in sialic acid uptake
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
  • N-acetylneuraminate and N-acetylmannosamine and N-acetylglucosamine degradation PW002030
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB00830N-Acetylneuraminic acidMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
carbohydrate transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
establishment of localization
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1491 bp
ATGAAATTGCACCATAGAATGCTCCGGCATTTTATCGCCGCAAGTGTCATTGTGCTGACA
TCTTCCTTCCTTATTTTTGAACTTGTCGCCAGCGACAGAGCAATGAGTGCCTATCTGCGC
TATATCGTGCAGAAAGCAGACTCCTCCTTTCTTTATGATAAGTATCAGAATCAGAGTATT
GCCGCGCATGTGATGCGCGCTCTCGCTGCTGAGCAGTCGGAAGTGTCGCCAGAACAGCGG
CGCGCCATCTGCGAGGCTTTTGAGTCTGCCAATAACACCCATGGCTTAAACCTGACTGCC
CATAAATACCCGGGCTTACGCGGCACACTACAAACCGCATCCACTGACTGCGACACAATT
GTGGAAGCTGCAGCACTATTACCCGCTTTTGATCAGGCAGTGGAAGGCAACCGCCACCAG
GATGATTACGGTTCAGGTCTTGGGATGGCCGAAGAGAAATTTCACTATTATCTCGATCTC
AATGACCGCTATGTCTATTTTTATGAGCCGGTTAATGTTGAATACTTTGCGATGAATAAC
TGGTCCTTCCTGCAGTCAGGAAGTATTGGCATCGATCGCAAAGATATTGAAAAGGTATTT
ACCGGGCGTACCGTATTGTCGAGCATTTACCAGGATCAGCGTACTAAACAGAACGTGATG
AGTTTGCTGACGCCGGTATATGTCGCAGGGCAGCTAAAAGGGATTGTGCTGCTGGATATT
AACAAAAACAATCTGCGGAATATCTTTTATACTCATGACCGCCCTCTCCTCTGGCGTTTT
CTCAATGTCACGCTAACCGATACCGATTCGGGGCGCGACATTATCATCAACCAGAGCGAA
GATAATCTGTTCCAGTATGTCAGTTACGTCCATGACTTACCGGGCGGCATTCGTGTCTCG
TTATCCATTGATATTCTTTACTTTATCACGTCTTCGTGGAAAAGCGTTCTGTTCTGGATT
TTGACGGCGTTAATTTTGCTGAATATGGTGCGGATGCACTTCCGTTTATACCAAAATGTG
TCGCGAGAAAATATTAGTGATGCGATGACTGGACTGTATAATCGCAAAATTTTAACCCCT
GAACTGGAGCAGCGGTTGCAGAAACTGGTGCAATCCGGTTCTTCGGTGATGTTTATTGCT
ATTGACATGGACAAGTTAAAGCAAATAAATGACACCCTCGGTCATCAGGAGGGGGATTTA
GCGATTACGTTATTAGCTCAGGCGATTAAACAGTCGATTCGTAAAAGTGATTATGCCATC
CGACTCGGTGGCGATGAATTCTGCATCATTCTTGTCGATTCGACGCCGCAAATTGCAGCA
CAACTGCCTGAACGTATCGAAAAACGTCTGCAACATATCGCGCCGCAGAAAGAGATCGGC
TTCTCTTCCGGTATTTACGCGATGAAAGAAAACGATACGTTACATGATGCGTATAAAGCT
TCCGATGAGCGTTTATATGTCAATAAGCAGAACAAAAACAGCCGTTCATGA
Protein Properties
Pfam Domain Function:
Protein Residues:496
Protein Molecular Weight:53551
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 22-42
  • 58-78
  • 92-112
  • 116-136
  • 148-168
  • 170-190
  • 224-244
  • 247-267
  • 278-298
  • 313-333
  • 355-375
  • 406-426
  • 431-451
Protein Sequence:
>Putative sialic acid transporter
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSAGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS
References
External Links:
ResourceLink
Uniprot ID:C4ZSW2
Uniprot Name:NANT_ECOBW
GenBank Gene ID:CP001396
Genebank Protein ID:238862240
CCDB:NANT_ECOBW
General Reference:
  • Ferenci, T., Zhou, Z., Betteridge, T., Ren, Y., Liu, Y., Feng, L., Reeves, P. R., Wang, L. (2009). "Genomic sequencing reveals regulatory mutations and recombinational events in the widely used MC4100 lineage of Escherichia coli K-12." J Bacteriol 191:4025-4029. Pubmed: 19376874