Canmetcon
Identification
Name:Threonine/serine transporter tdcC
Synonyms:
  • H(+)/threonine-serine symporter
Gene Name:tdcC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Involved in the import of threonine and serine into the cell, with the concomitant import of a proton (symport system)
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB01362Hydrogen (gas)MetaboCard
ECMDB00187L-SerineMetaboCard
ECMDB00167L-ThreonineMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1332 bp
ATGCAACCGTCCAGAAACTTTGACGATCTCAAATTCTCCTCTATTCACCGCCGCATTTTG
CTGTGGGGAAGCGGTGGTCCGTTTCTGGATGGTTATGTACTGGTAATGATTGGCGTGGCG
CTGGAGCAACTGACGCCGGCGCTGAAACTGGACGCTGACTGGATTGGCTTGCTGGGCGCG
GGAACGCTCGCCGGGCTGTTCGTTGGCACATCGCTGTTTGGTTATATTTCCGATAAAGTC
GGACGGCGCAAAATGTTCCTCATTGATATCATCGCCATCGGCGTGATATCGGTGGCGACG
ATGTTTGTTTCATCCCCCGTCGAACTGTTGGTGATGCGGGTACTTATCGGCATTGTCATC
GGTGCAGATTATCCCATCGCCACCTCAATGATCACCGAGTTCTCCAGTACCCGTCAGCGG
GCGTTTTCCATCAGCTTTATTGCCGCGATGTGGTATGTCGGCGCGACCTGTGCCGATCTG
GTCGGCTACTGGCTTTATGATGTGGAAGGCGGCTGGCGCTGGATGCTGGGTAGCGCGGCG
ATCCCCTGTTTGTTGATTTTGATTGGTCGATTCGAACTGCCTGAATCTCCCCGCTGGTTA
TTACGCAAAGGGCGAGTAAAAGAGTGCGAAGAGATGATGATCAAACTGTTTGGCGAACCG
GTGGCTTTCGATGAAGAGCAGCCGCAGCAAACCCGTTTTCGCGATCTGTTTAATCGCCGC
CATTTTCCTTTTGTTCTGTTTGTTGCCGCCATCTGGACCTGCCAGGTGATCCCAATGTTC
GCCATTTACACCTTTGGCCCGCAAATCGTTGGTTTGTTGGGATTGGGGGTTGGCAAAAAC
GCGGCACTAGGGAATGTGGTGATTAGCCTGTTCTTTATGCTCGGCTGTATTCCGCCGATG
CTGTGGTTAAACACTGCCGGACGGCGTCCATTGTTGATTGGCAGCTTTGCCATGATGACG
CTGGCGCTGGCGGTTTTGGGGCTAATCCCGGATATGGGGATCTGGCTGGTAGTGATGGCC
TTTGCGGTGTATGCCTTTTTCTCTGGCGGGCCGGGTAATTTGCAGTGGCTCTATCCTAAT
GAACTCTTCCCGACAGATATCCGCGCCTCTGCCGTGGGCGTGATTATGTCCTTAAGTCGT
ATTGGCACCATTGTTTCGACCTGGGCACTACCGATCTTTATCAATAATTACGGTATCAGT
AACACGATGCTAATGGGGGCGGGTATCTCGCTGTTTGGCTTGTTGATTTCCGTAGCGTTT
GCCCCGGAGACTCGAGGGATGTCACTGGCGCAGACCAGCAATATGACGATCCGCGGGCAG
AGAATGGGGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:443
Protein Molecular Weight:48878
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • 22-42
  • 44-64
  • 97-117
  • 140-160
  • 163-183
  • 207-227
  • 261-281
  • 311-331
  • 366-386
  • 389-409
  • 423-443
Protein Sequence:
>Threonine/serine transporter tdcC
MSTSDSIVSSQTKQSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILLMLVLAY
PIAFYCHRALARLCLSGSNPSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTIT
NTFMTFWENQLGFAPLNRGFVALFLLLLMAFVIWFGKDLMVKVMSYLVWPFIASLVLISL
SLIPYWNSAVIDQVDLGSLSLTGHDGILITVWLGISIMVFSFNFSPIVSSFVVSKREEYE
KDFGRDFTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPANMAEAKAQNIPVLSYLANH
FASMTGTKTTFAITLEYAASIIALVAIFKSFFGHYLGTLEGLNGLVLKFGYKGDKTKVSL
GKLNTISMIFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPSLAKYRG
RLDNVFVTVIGLLTILNIVYKLF
References
External Links:
ResourceLink
Uniprot ID:C4ZR30
Uniprot Name:TDCC_ECOBW
GenBank Gene ID:CP001396
Genebank Protein ID:238863188
CCDB:TDCC_ECOBW
General Reference:
  • Ferenci, T., Zhou, Z., Betteridge, T., Ren, Y., Liu, Y., Feng, L., Reeves, P. R., Wang, L. (2009). "Genomic sequencing reveals regulatory mutations and recombinational events in the widely used MC4100 lineage of Escherichia coli K-12." J Bacteriol 191:4025-4029. Pubmed: 19376874